Inligting

15.16: Fisiese Bewyse - Biologie

15.16: Fisiese Bewyse - Biologie


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Fossiele

Fossiele verskaf vaste bewyse dat organismes uit die verlede nie dieselfde is as dié wat vandag gevind word nie, en fossiele toon 'n vordering van evolusie. Byvoorbeeld, wetenskaplikes het hoogs gedetailleerde rekords gevind wat die evolusie van mense en perde toon (Figuur 1b).

Anatomie en Embriologie

Nog 'n tipe bewyse vir evolusie is die teenwoordigheid van strukture in organismes wat dieselfde basiese vorm deel. Byvoorbeeld, die bene in die aanhangsels van 'n mens, hond, voël en walvis deel almal dieselfde algehele konstruksie (Figuur 2) wat voortspruit uit hul oorsprong in die aanhangsels van 'n gemeenskaplike voorouer. Met verloop van tyd het evolusie gelei tot veranderinge in die vorms en groottes van hierdie bene in verskillende spesies, maar hulle het dieselfde algehele uitleg gehandhaaf. Wetenskaplikes noem hierdie sinonieme dele homoloë strukture.

Sommige strukture bestaan ​​in organismes wat geen oënskynlike funksie het nie, en blyk oorblywende dele van 'n vorige gemeenskaplike voorouer te wees. Hierdie ongebruikte strukture sonder funksie word vestigiale strukture genoem. Enkele voorbeelde van vestigiale strukture is vlerke op voëls wat nie vlieg nie, blare op sommige kaktusse en agterbeenbene by walvisse.

Besoek hierdie interaktiewe webwerf om te raai watter beenstrukture homoloog is en watter analoog is, en sien voorbeelde van evolusionêre aanpassings om hierdie konsepte te illustreer.

Nog 'n bewys van evolusie is die konvergensie van vorm in organismes wat soortgelyke omgewings deel. Byvoorbeeld, spesies van onverwante diere, soos die arktiese jakkals en ryp, wat in die arktiese streek woon, is gekies vir seisoenale wit fenotipes gedurende die winter om met die sneeu en ys te meng (Figuur 3). Hierdie ooreenkomste kom nie voor as gevolg van gemeenskaplike afkoms nie, maar as gevolg van soortgelyke seleksiedruk—die voordele daarvan om nie deur roofdiere gesien te word nie.

Embriologie, die studie van die ontwikkeling van die anatomie van 'n organisme tot sy volwasse vorm, lewer ook bewyse van verwantskap tussen nou wyd uiteenlopende groepe organismes. Mutasie-aanpassing in die embrio kan sulke groter gevolge in die volwassene hê dat embriovorming geneig is om bewaar te word. Gevolglik verskyn strukture wat in sommige groepe afwesig is, dikwels in hul embrioniese vorms en verdwyn teen die tyd dat die volwasse of jeugdige vorm bereik word. Byvoorbeeld, alle gewerwelde embrio's, insluitend mense, vertoon op 'n stadium in hul vroeë ontwikkeling kieusplete en sterte. Hierdie verdwyn in die volwassenes van landgroepe, maar word in volwasse vorme van watergroepe soos visse en sommige amfibieë onderhou. Groot-aap-embrio's, insluitend mense, het 'n stertstruktuur tydens hul ontwikkeling wat verlore gaan teen die tyd van geboorte.

Leerdoelwitte

Sedert Darwin sy idees oor afkoms met verandering en die druk van natuurlike seleksie ontwikkel het, is 'n verskeidenheid bewyse versamel wat die evolusieteorie ondersteun. Fossiele bewyse toon die veranderinge in geslagte oor miljoene jare, soos in hominiede en perde. Die bestudering van anatomie stel wetenskaplikes in staat om homoloë strukture oor verskillende groepe verwante organismes, soos beenbene, te identifiseer. Vestigiale strukture bied ook leidrade aan gemeenskaplike voorouers. Deur embriologie te gebruik, kan wetenskaplikes gemeenskaplike voorouers identifiseer deur strukture wat slegs tydens ontwikkeling teenwoordig is en nie in die volwasse vorm nie.


Myeloïde PTEN bevorder chemoterapie-geïnduseerde NLRP3-inflammasoom aktivering en antitumor immuniteit

PTEN is 'n dubbel-spesifisiteit fosfatase wat gereeld in menslike kanker gemuteer word, en sy tekort aan kanker is geassosieer met terapieweerstand en swak oorlewing. Alhoewel die intrinsieke tumor-onderdrukker funksie van PTEN goed gevestig is, ontbreek bewyse van sy rol in die tumor immuun mikro-omgewing. Hier wys ons dat chemoterapie-geïnduseerde antitumor-immuunresponse en tumor-onderdrukking staatmaak op myeloïde-sel PTEN, wat noodsaaklik is vir chemoterapie-geïnduseerde aktivering van die NLRP3 inflammasoom en antitumor immuniteit. PTEN is direk in wisselwerking met en defosforileer NLRP3 om NLRP3-ASC-interaksie, inflammasoomsamestelling en aktivering moontlik te maak. Belangrik, aanvulling van IL-1β herstel chemoterapie sensitiwiteit in muis myeloïde selle met 'n PTEN tekort. Klinies is chemoterapie-geïnduseerde IL-1β-produksie en antitumor-immuniteit by pasiënte met kanker gekorreleer met PTEN-uitdrukking in myeloïede selle, maar nie tumorselle nie. Ons resultate toon dat myeloïde PTEN chemoterapie-responsiwiteit kan bepaal deur NLRP3-afhanklike antitumor-immuniteit te bevorder en stel voor dat myeloïde PTEN 'n potensiële biomerker kan wees om chemoterapie-reaksies te voorspel.


Toegang opsies

Kry volledige joernaaltoegang vir 1 jaar

Alle pryse is NETTO pryse.
BTW sal later by die betaalpunt bygevoeg word.
Belastingberekening sal tydens afhandeling gefinaliseer word.

Kry tydsbeperkte of volledige artikeltoegang op ReadCube.

Alle pryse is NETTO pryse.


Preoperatiewe toetsing voor nie-kardiale chirurgie: riglyne en aanbevelings

Hierdie weergawe van die artikel bevat aanvullende inhoud.

Artikel Afdelings

Preoperatiewe toetse (bv. borsradiografie, elektrokardiografie, laboratoriumtoetse, urinalise) word dikwels voor chirurgiese prosedures uitgevoer. Hierdie ondersoeke kan nuttig wees om risiko te stratifiseer, narkose-keuses te rig en postoperatiewe bestuur te lei, maar word dikwels verkry as gevolg van protokol eerder as mediese noodsaaklikheid. Die besluit om preoperatiewe toetse te bestel moet gelei word deur die pasiënt se kliniese geskiedenis, comorbiditeite en fisiese ondersoekbevindinge. Pasiënte met tekens of simptome van aktiewe kardiovaskulêre siekte moet met toepaslike toetse geëvalueer word, ongeag hul preoperatiewe status. Elektrokardiografie word aanbeveel vir pasiënte wat hoërisiko-operasies ondergaan en diegene wat intermediêre-risiko-chirurgie ondergaan wat bykomende risikofaktore het. Pasiënte wat laerisiko-chirurgie ondergaan, benodig nie elektrokardiografie nie. Borsradiografie is redelik vir pasiënte wat die risiko loop van postoperatiewe pulmonale komplikasies as die resultate perioperatiewe bestuur sou verander. Preoperatiewe urinale ontleding word aanbeveel vir pasiënte wat indringende urologiese prosedures ondergaan en diegene wat inplanting van vreemde materiaal ondergaan. Elektroliet- en kreatinientoetse moet uitgevoer word by pasiënte met onderliggende chroniese siektes en diegene wat medikasie neem wat hulle vatbaar maak vir elektrolietafwykings of nierversaking. Ewekansige glukosetoetsing moet uitgevoer word by pasiënte met 'n hoë risiko van ongediagnoseerde diabetes mellitus. By pasiënte met gediagnoseerde diabetes word A1C-toetse slegs aanbeveel indien die resultaat perioperatiewe bestuur sou verander. 'n Volledige bloedtelling word aangedui vir pasiënte met siektes wat die risiko van bloedarmoede verhoog of pasiënte by wie beduidende perioperatiewe bloedverlies verwag word. Koagulasiestudies word gereserveer vir pasiënte met 'n geskiedenis van bloeding of mediese toestande wat hulle vatbaar maak vir bloeding, en vir diegene wat antikoagulante neem. Pasiënte in hul gewone gesondheidstoestand wat katarakchirurgie ondergaan, benodig nie preoperatiewe toetsing nie.

Die doel van preoperatiewe evaluering is om toestande te identifiseer en te optimaliseer wat perioperatiewe morbiditeit en mortaliteit verhoog. Histories het toetsing voor nie-kardiale chirurgie 'n reeks standaardtoetse behels wat op alle pasiënte toegepas is (bv. borskasradiografie, elektrokardiografie [EKG], laboratoriumtoetse, urinalise). Hierdie toetse verander egter dikwels nie perioperatiewe bestuur nie, kan lei tot opvolgtoetse met resultate wat dikwels normaal is, en kan chirurgie onnodig vertraag, wat alles die koste van sorg verhoog. 'n Uitgebreide sistematiese oorsig het tot die gevolgtrekking gekom dat daar geen bewyse was om roetine preoperatiewe toetsing te ondersteun nie.1

Meer onlangse praktykriglyne gaan voort om toetsing in uitgesoekte pasiënte aan te beveel wat gelei word deur 'n perioperatiewe risiko-assessering gebaseer op pertinente kliniese geskiedenis en ondersoekbevindinge, alhoewel hierdie aanbeveling hoofsaaklik op deskundige mening of laevlakbewyse gebaseer is.2 – 9 Baie van die aanbevelings sluit bewoording in soos ȁoorweeg om te toets of ” of “toetsing redelik kan wees.” Aanbevelings is nie altyd gebruikersvriendelik nie. Byvoorbeeld, die riglyn van die Nasionale Instituut vir Kliniese Uitnemendheid, wat dalk die mees wetenskaplik streng van die groep is, sluit 36 ​​tabelle in wat deur middel van 'n vloeidiagram georganiseer is waarna dokters kan verwys om 'n besluit vir of teen toetsing te neem.8 Alhoewel die riglyn wetenskaplik is, is dit omslagtige aard maak dit ondoeltreffend in 'n besige kliniese omgewing.

Primêresorggeneeshere is in 'n ideale posisie om 'n aktiewe rol te speel in die multidissiplinêre, sisteemgebaseerde benadering om preoperatiewe toetsstandaarde vir hul eie instellings te definieer om hoëgehalte, kostedoeltreffende gesondheidsorg te verskaf. Hierdie artikel vergelyk en kontrasteer sleutelriglyne en die bewyse wat hulle aanhaal, en maak aanbevelings vir die primêre sorg dokter wat die preoperatiewe pasiënt evalueer. Gedetailleerde kaarte wat die individuele riglynaanbevelings uiteensit, is beskikbaar as 'n aanlynbylaag.

SORTEER: SLEUTELAANBEVELINGS VIR OEFENING

Die besluit om preoperatiewe toetse uit te voer moet gebaseer wees op die geskiedenis en fisiese ondersoekbevindinge, perioperatiewe risiko-assessering en kliniese oordeel.


Verwysings

Hanahan, D. & Weinberg, R. A. Kenmerke van kanker: die volgende generasie. Sel 144, 646–674 (2011). 'n Omvattende oorsig van kanker.

Ronnov-Jessen, L., Petersen, O. W. & Bissell, M. J. Sellulêre veranderinge betrokke by omskakeling van normale na kwaadaardige bors: belangrikheid van die stromale reaksie. Fisiol. Ds. 76, 69–125 (1996).

Vong, S. & Kalluri, R. Die rol van stromale miofibroblast en ekstrasellulêre matriks in tumor angiogenese. Gene Kanker 2, 1139–1145 (2011).

Quail, D. F. & Joyce, J. A. Mikro-omgewingsregulering van tumorprogressie en metastase. Nat. Med. 19, 1423–1437 (2013). 'N Goeie oorsig van die tumor mikro-omgewing.

Kalluri, R. Basement membrane: struktuur, samestelling en rol in tumor angiogenese. Nat. Ds Kanker 3, 422–433 (2003).

Hanahan, D. & Coussens, L. M. Bykomstighede tot die misdaad: funksies van selle wat na die tumormikro-omgewing gewerf is. Kankersel 21, 309–322 (2012).

Pietras, K. & Ostman, A. Kenmerke van kanker: interaksies met die tumorstroma. Exp. Sel Res. 316, 1324–1331 (2010).

Bhowmick, N.A. et al. TGF-β sein in fibroblaste moduleer die onkogene potensiaal van aangrensende epithelia. Wetenskap 303, 848–851 (2004).

Lujambio, A. et al. Nie-sel-outonome tumor onderdrukking deur p53. Sel 153, 449–460 (2013).

Coussens, L. M. & Werb, Z. Inflammasie en kanker. Natuur 420, 860–867 (2002).

Kalluri, R. & Zeisberg, M. Fibroblaste in kanker. Nat. Ds Kanker 6, 392–401 (2006).

Ohlund, D., Elyada, E. & Tuveson, D. Fibroblast heterogeniteit in die kanker wond. J. Exp. Med. 211, 1503–1523 (2014). 'n Oorsig oor CAF's en hul waarskynlike heterogeniteit.

Marsh, T., Pietras, K. & McAllister, S. S. Fibroblaste as argitekte van kankerpatogenese. Biochim. Biofis. Acta 1832, 1070–1078 (2013).

Ostman, A. & Augsten, M. Kanker-geassosieerde fibroblaste en tumorgroei-omstanders wat in sleutelspelers verander. Curr. Mening. Genet. Dev. 19, 67–73 (2009).

Tampe, B. & Zeisberg, M. Bydrae van genetika en epigenetika tot progressie van nierfibrose. Nephrol. Skakel. Transpl. 29 (Bylae 4), iv72–iv79 (2013).

Zeisberg, E. M. & Zeisberg, M. Die rol van promotor-hipermetilering in fibroblastaktivering en fibrogenese. J. Pathol. 229, 264–273 (2013).

Micallef, L. et al. Die miofibroblast, veelvuldige oorsprong vir hoofrolle in normale en patologiese weefselherstel. Fibrogenese Weefselherstel 5, S5 (2012).

Ronnov-Jessen, L. & Petersen, O. W. Induksie van α-gladde spieraktien deur groeifaktor-β1 te transformeer in stil menslike borsklier fibroblaste. Implikasies vir miofibroblastgenerering in borsneoplasie. Lab. Belê. 68, 696–707 (1993).

Paunescu, V. et al. Tumor-geassosieerde fibroblaste en mesenchimale stamselle: meer ooreenkomste as verskille. J. Sel. Mol. Med. 15, 635–646 (2011). 'n Omvattende vergelykende ontleding van MSC's en CAF's.

Sappino, A. P., Skalli, O., Jackson, B., Schurch, W. & Gabbiani, G. Gladde-spier-differensiasie in stromale selle van kwaadaardige en nie-kwaadaardige borsweefsels. Int. J. Kanker 41, 707–712 (1988).

Powell, D.W. et al. Miofibroblaste. I. Parakriene selle belangrik in gesondheid en siekte. Am. J. Fisiol. 277, C1-C9 (1999).

LeBleu, V. S. et al. Oorsprong en funksie van miofibroblaste in nierfibrose. Nat. Med. 19, 1047–1053 (2013).

Zeisberg, M., Strutz, F. & Muller, G. A. Rol van fibroblastaktivering in die indusering van interstisiële fibrose. J. Nephrol. 13 (Bylae 3), S111–S120 (2000).

Desmouliere, A., Darby, I. A. & Gabbiani, G. Normale en patologiese sagteweefselhermodellering: rol van die miofibroblast, met spesiale klem op lewer- en nierfibrose. Lab. Belê. 83, 1689–1707 (2003).

Lajiness, J. D. & Conway, S. J. Die dinamiese rol van kardiale fibroblaste in ontwikkeling en siekte. J. Cardiovasc. Transl Res. 5, 739–748 (2012).

Dvorak, H. F. Tumors: wonde wat nie genees nie. Ooreenkomste tussen tumorstroma generasie en wondgenesing. N. Engl. J. Med. 315, 1650–1659 (1986).

Monaco, J. L. & Lawrence, W. T. Akute wondgenesing 'n oorsig. Clin. Plast. Surg. 30, 1–12 (2003).

Gurtner, G. C., Werner, S., Barrandon, Y. & Longaker, M. T. Wondherstel en regenerasie. Natuur 453, 314–321 (2008).

Bliss, L. A. et al. Gebruik van nadoodse menslike dura mater en kopvel vir die afleiding van menslike fibroblastkulture. PLoS Een 7, e45282 (2012).

Virchow, R. Die Cellularpathologie in lhrer Begruendung auf Physiologische und Pathologische Gewebelehre (red. Hirschwald, A.) (Berlyn, 1858).

Duvall, M. Atlas d'Embryologie. (red. Masson, G.) (Parys, 1879).

Tarin, D. & Croft, C. B. Ultrastrukturele kenmerke van wondgenesing in muisvel. J. Anat. 105, 189–190 (1969).

Gabbiani, G., Ryan, G. B. & Majne, G. Teenwoordigheid van gemodifiseerde fibroblaste in granulasieweefsel en hul moontlike rol in wondsametrekking. Experientia 27, 549–550 (1971).

Darby, I. A., Laverdet, B., Bonte, F. & Desmouliere, A. Fibroblaste en miofibroblaste in wondgenesing. Clin. Skoonmaakmiddel. Ondersoek. Dermatol. 7, 301–311 (2014).

Castor, C. W., Wilson, S. M., Heiss, P. R. & Seidman, J. C. Aktivering van longbindweefselselle in vitro. Am. Ds Respir. Dis. 120, 101–106 (1979).

Muller, G. A. & Rodemann, H. P. Karakterisering van menslike nierfibroblaste in gesondheid en siekte: I. Immunofenotipering van gekweekte tubulêre epiteelselle en fibroblaste afkomstig van niere met histologies bewese interstisiële fibrose. Am. J. Nier Dis. 17, 680–683 (1991).

Tomasek, J. J., Gabbiani, G., Hinz, B., Chaponnier, C. & Brown, R. A. Myofibroblaste en megano-regulering van bindweefselhermodellering. Nat. Ds Mol. Sel Biol. 3, 349–363 (2002).

Pastorie, G. et al. 'n Stromale adreskode gedefinieer deur fibroblaste. Tendense Immunol. 26, 150–156 (2005).

Karnoub, A. E. et al. Mesenchimale stamselle binne tumorstroma bevorder borskankermetastase. Natuur 449, 557–563 (2007). 'n Studie wat toon dat MSC-afgeleide CCL5 borskankermetastase verbeter.

Quante, M. et al. Beenmurg-afgeleide miofibroblaste dra by tot die mesenchimale stamselnis en bevorder tumorgroei. Kankersel 19, 257–272 (2011). 'n Studie wat aandui dat MSC-afgeleide CAF's inflammasie-geïnduseerde maagkanker progressie bevorder en gekenmerk word deur globale DNA hipometilering en verhoogde uitdrukking van IL-6, WNT5A en beenmorfogenetiese proteïen 4 (BMP4).

Xu, J. et al. Bydrae van beenmurg-afgeleide fibrosiete tot lewerfibrose. Hepatobiliêre Chirurg. Nutr. 4, 34–47 (2015).

Raab, S., Klingenstein, M., Liebau, S. & Linta, L. A. Vergelykende siening oor menslike somatiese selbronne vir iPSC-generering. Stamselle Int. 2014, 768391 (2014).

Lorenz, K. et al. Multilyn-differensiasiepotensiaal van menslike dermale vel-afgeleide fibroblaste. Exp. Dermatol. 17, 925–932 (2008).

Miyake, T. & Kalluri, R. Kardiale biologie: selplastisiteit help harte om te herstel. Natuur 514, 575–576 (2014).

Ubil, E. et al. Mesenchimaal-endoteeloorgang dra by tot kardiale neovaskularisasie. Natuur 514, 585–590 (2014).

Sriram, G., Bigliardi, P. L. & Bigliardi-Qi, M. Fibroblast heterogeniteit en die implikasies daarvan vir die ingenieurswese van organotipiese velmodelle in vitro. EUR. J. Cell Biol. 94, 483–512 (2015).

Driskell, R. R. & Watt, F. M. Verstaan ​​fibroblast heterogeniteit in die vel. Tendense Cell Biol. 25, 92–99 (2015).

Rodemann, H. P. & Muller, G. A. Karakterisering van menslike nierfibroblaste in gesondheid en siekte: II. In vitro groei, differensiasie en kollageensintese van fibroblaste vanaf niere met interstisiële fibrose. Am. J. Nier Dis. 17, 684–686 (1991).

Simian, M. et al. Die wisselwerking van matriksmetalloproteïnases, morfogene en groeifaktore is nodig vir vertakking van melkepiteelselle. Ontwikkeling 128, 3117–3131 (2001).

Wiseman, B. S. & Werb, Z. Stromale effekte op melkklierontwikkeling en borskanker. Wetenskap 296, 1046–1049 (2002).

Driskell, R. R. et al. Afsonderlike fibroblast-afstammelinge bepaal dermale argitektuur in velontwikkeling en herstel. Natuur 504, 277–281 (2013).

Dulauroy, S., Di Carlo, S. E., Langa, F., Eberl, G. & Peduto, L. Afkomsnasporing en genetiese ablasie van ADAM12 + perivaskulêre selle identifiseer 'n groot bron van profibrotiese selle tydens akute weefselbesering. Nat. Med. 18, 1262–1270 (2012).

Hamburg-Shields, E., DiNuoscio, G. J., Mullin, N. K., Lafyatis, R. & Atit, R. P. Volgehoue ​​β-catenin-aktiwiteit in dermale fibroblaste bevorder fibrose deur die opregulering van uitdrukking van ekstrasellulêre matriks-proteïenkoderende gene. J. Pathol. 235, 686–697 (2015).

Rock, J.R. et al. Veelvuldige stromale populasies dra by tot pulmonale fibrose sonder bewyse vir epiteel- na mesenchimale oorgang. Proc. Natl Acad. Wetenskap. VSA 108, E1475–E1483 (2011).

De Wever, O., Van Bockstal, M., Mareel, M., Hendrix, A. & Bracke, M. Karsinoom-geassosieerde fibroblaste verskaf operasionele buigsaamheid in metastase. Semin. Kanker Biol. 25, 33–46 (2014).

Dumont, N. et al. Borsfibroblaste moduleer vroeë disseminasie, tumorgenese en metastase deur verandering van ekstrasellulêre matrikseienskappe. Neoplasie 15, 249–262 (2013).

Ryan, G. B. et al. Miofibroblaste in 'n avaskulêre veselagtige weefsel. Lab. Belê. 29, 197–206 (1973).

Ryan, G. B. et al. Miofibroblaste in menslike granulasieweefsel. Hom. Pathol. 5, 55–67 (1974).

Tsukada, T., McNutt, M. A., Ross, R. & Gown, A. M. HHF35, 'n spieraktien-spesifieke monoklonale teenliggaam. II. Reaktiwiteit in normale, reaktiewe en neoplastiese menslike weefsels. Am. J. Pathol. 127, 389–402 (1987).

Schor, S. L., Schor, A. M., Grey, A. M. & Rushton, G.Fetale en kankerpasiënte fibroblaste produseer 'n outokriene migrasie-stimulerende faktor wat nie deur normale volwasse selle gemaak word nie. J. Cell Sci. 90, 391–399 (1988).

Durning, P., Schor, S. L. & Sellwood, R. A. Fibroblaste van pasiënte met borskanker toon abnormale migrerende gedrag in vitro. Lancet 2, 890–892 (1984).

Elenbaas, B. & Weinberg, R. A. Heterotipiese sein tussen epiteel tumorselle en fibroblaste in karsinoomvorming. Exp. Sel Res. 264, 169–184 (2001).

Lohr, M. et al. Transformerende groeifaktor-β1 veroorsaak desmoplasie in 'n eksperimentele model van menslike pankreaskarsinoom. Kanker Res. 61, 550–555 (2001).

Aoyagi, Y. et al. Ooruitdrukking van TGF-β deur geïnfiltreerde granulosiete korreleer met die uitdrukking van kollageen mRNA in pankreaskanker. Br. J. Kanker 91, 1316–1326 (2004).

Ishii, G., Ochiai, A. & Neri, S. Fenotipiese en funksionele heterogeniteit van kankergeassosieerde fibroblaste binne die tumormikro-omgewing. Adv. Dwelmaflewering Ds. 99, 186–196 (2015).

Bronzert, D. A. et al. Sintese en afskeiding van bloedplaatjie-afgeleide groeifaktor deur menslike borskankersellyne. Proc. Natl Acad. Wetenskap. VSA 84, 5763–5767 (1987).

Hanahan, D. & Weinberg, R. A. Die kenmerke van kanker. Sel 100, 57–70 (2000).

Dvorak, H. F., Form, D. M., Manseau, E. J. & Smith, B. D. Patogenese van desmoplasie. I. Immunofluoressensie-identifikasie en lokalisering van sommige strukturele proteïene van lyn 1 en lyn 10 marmotgewasse en van genesende wonde. J. Natl Kanker Inst. 73, 1195–1205 (1984).

Folkman, J. & Kalluri, R. Kanker sonder siekte. Natuur 427, 787 (2004). 'n Konsepstuk wat die kankerbeperkende aksies van desmoplasie voorstel en dat kanker kan bestaan ​​sonder om kliniese siektes tot gevolg te hê.

Polyak, K. & Kalluri, R. Die rol van die mikro-omgewing in melkklier ontwikkeling en kanker. Koue Lente Harb. Perspektief. Biol. 2, a003244 (2010).

Erez, N., Truitt, M., Olson, P., Arron, S. T. & Hanahan, D. Kanker-geassosieerde fibroblaste word geaktiveer in beginnende neoplasie om tumorbevorderende inflammasie op 'n NF-κB-afhanklike wyse te orkestreer. Kankersel 17, 135–147 (2010). 'n Interessante studie wat aandui dat CAF's 'n pro-inflammatoriese geenuitdrukkingsprogram in die vroeë stadiums van neoplasie verkry.

Dolberg, D. S., Hollingsworth, R., Hertle, M. & Bissell, M. J. Wonding en sy rol in RSV-gemedieerde tumorvorming. Wetenskap 230, 676–678 (1985).

Schuh, A. C., Keating, S. J., Monteclaro, F. S., Vogt, P. K. & Breitman, M. L. Verpligte wondvereiste vir tumorgenese in v-jun transgeniese muise. Natuur 346, 756–760 (1990).

Li, J. et al. Idiopatiese pulmonale fibrose sal die risiko van longkanker verhoog. Chinese Med. J. 127, 3142–3149 (2014).

Park, J. et al. Longkanker by pasiënte met idiopatiese pulmonale fibrose. EUR. Respir. J. 17, 1216–1219 (2001).

Samet, J. M. Verhoog idiopatiese pulmonale fibrose die risiko van longkanker? Am. J. Respir. Krit. Sorg Med. 161, 1–2 (2000).

Sangiovanni, A. et al. Verhoogde oorlewing van sirrotiese pasiënte met 'n hepatosellulêre karsinoom wat tydens toesig opgespoor is. Gastroënterologie 126, 1005–1014 (2004).

Wang, H. M. et al. Meting van lewerstyfheid as 'n alternatief vir fibrotiese stadium in risikobepaling van hepatosellulêre karsinoom voorkoms vir chroniese hepatitis C pasiënte. Lewer Int. 33, 756–761 (2013).

Fukumura, D. et al. Tumorinduksie van VEGF-promotoraktiwiteit in stromale selle. Sel 94, 715–725 (1998).

Brown, L. F. et al. Vaskulêre stroma vorming in karsinoom in situ, indringende karsinoom en metastatiese karsinoom van die bors. Clin. Kanker Res. 5, 1041–1056 (1999).

Feng, D. et al. Ultrastrukturele lokalisering van die vaskulêre deurlaatbaarheidsfaktor/vaskulêre endoteelgroeifaktor (VPF/VEGF) reseptor-2 (FLK-1, KDR) in normale muisnier en in die hiperpermeabele vate geïnduseer deur VPF/VEGF-uitdrukkingsgewasse en adenovirale vektore. J. Histochem. Sitochem. 48, 545–556 (2000).

Leung, D. W., Cachianes, G., Kuang, W. J., Goeddel, D. V. & Ferrara, N. Vaskulêre endoteelgroeifaktor is 'n afgeskeide angiogeniese mitogeen. Wetenskap 246, 1306–1309 (1989).

Giussani, M., Merlino, G., Cappelletti, V., Tagliabue, E. & Daidone, M. G. Tumor-ekstrasellulêre matriks interaksies: Identifikasie van gereedskap wat verband hou met borskanker vordering. Semin. Kanker Biol. 35, 3–10 (2015).

Chiquet-Ehrismann, R., Mackie, E. J., Pearson, C. A. & Sakakura, T. Tenascin: 'n ekstrasellulêre matriksproteïen betrokke by weefselinteraksies tydens fetale ontwikkeling en onkogenese. Sel 47, 131–139 (1986).

Mackie, E. J. et al. Tenascin is 'n stromale merker vir epiteel-maligniteit in die melkklier. Proc. Natl Acad. Wetenskap. VSA 84, 4621–4625 (1987).

Kyutoku, M. et al. Rol van periostien in kanker vordering en metastase: inhibisie van borskanker vordering en metastase deur anti-periostin teenliggaampies in 'n muriene model. Int. J. Mol. Med. 28, 181–186 (2011).

Ruan, K., Bao, S. & Ouyang, G. Die veelvlakkige rol van periostin in tumorgenese. Sel. Mol. Lewenswetenskap. 66, 2219–2230 (2009).

Abdollahi, A. et al. Inhibisie van plaatjie-afgeleide groeifaktor sein verswak pulmonale fibrose. J. Exp. Med. 201, 925–935 (2005).

Pietras, K., Pahler, J., Bergers, G. & Hanahan, D. Funksies van parakriene PDGF-sein in die proangiogene tumorstroma wat deur farmakologiese teiken geopenbaar is. PLoS Med. 5, e19 (2008).

Paulsson, J., Ehnman, M. & Ostman, A. PDGF-reseptore in tumorbiologie: prognostiese en voorspellende potensiaal. Toekomstige Oncol. 10, 1695–1708 (2014).

Strutz, F. et al. Identifikasie en karakterisering van 'n fibroblastmerker: FSP1. J. Cell Biol. 130, 393–405 (1995).

Osterreicher, C. H. et al. Fibroblast-spesifieke proteïen 1 identifiseer 'n inflammatoriese subpopulasie van makrofage in die lewer. Proc. Natl Acad. Wetenskap. VSA 108, 308–313 (2011).

Kikuchi, N. et al. Kernuitdrukking van S100A4 word geassosieer met aggressiewe gedrag van epiteel-ovariumkarsinoom: 'n belangrike outokriene/parakriene faktor in tumorprogressie. Kanker Wetenskap. 97, 1061–1069 (2006).

Arnold, J. N., Magiera, L., Kraman, M. & Fearon, D. T. Tumorale immuunonderdrukking deur makrofage wat fibroblastaktiveringsproteïen-α en heem-oksigenase-1 uitdruk. Kanker Immunol. Res. 2, 121–126 (2014).

Armulik, A., Genove, G. & Betsholtz, C. Pericytes: ontwikkelings-, fisiologiese en patologiese perspektiewe, probleme en beloftes. Dev. Sel 21, 193–215 (2011).

Ozdemir, B.C. et al. Uitputting van karsinoom-geassosieerde fibroblaste en fibrose veroorsaak immuunonderdrukking en versnel pankreaskanker met verminderde oorlewing. Kankersel 25, 719–734 (2014). Hierdie vraestel toon dat uitputting van α SMA + stromale selle bevorder 'n immuunonderdrukkende tumormilieu en vererger kankerprogressie met verminderde oorlewing.

Sugimoto, H., Mundel, T. M., Kieran, M. W. & Kalluri, R. Identifikasie van fibroblast heterogeniteit in die tumor mikro-omgewing. Kanker Biol. Daar. 5, 1640–1646 (2006).

Guido, C. et al. Metaboliese herprogrammering van kanker-geassosieerde fibroblaste deur TGF-β dryf tumorgroei: verbind TGF-β-sein met "Warburg-agtige" kankermetabolisme en L-laktaatproduksie. Selsiklus 11, 3019–3035 (2012).

Simpkins, S. A., Hanby, A. M., Holliday, D. L. & Speirs, V. Kliniese en funksionele betekenis van verlies van caveolien-1-uitdrukking in borskanker-geassosieerde fibroblaste. J. Pathol. 227, 490–498 (2012).

Goetz, J. G. et al. Biomeganiese hermodellering van die mikro-omgewing deur stromale caveolien-1 bevoordeel tumorindringing en metastase. Sel 146, 148–163 (2011).

Li, P. et al. Epigenetiese stillegging van mikroRNA-149 in kankergeassosieerde fibroblaste bemiddel prostaglandien E2/interleukien-6-sein in die tumormikro-omgewing. Sel Res. 25, 588–603 (2015).

Mrazek, A. A. et al. Kolorektale kanker-geassosieerde fibroblaste is genotipies onderskeibaar. Curr. Kanker Ther. Ds. 10, 97–218 (2014).

Hu, M. et al. Verskillende epigenetiese veranderinge in die stromale selle van borskanker. Nat. Genet. 37, 899–905 (2005).

Bechtel, W. et al. Metilering bepaal fibroblastaktivering en fibrogenese in die nier. Nat. Med. 16, 544–550 (2010). Die eerste studie om epigenetiese beheer van fibroblastaktivering te impliseer.

Huang, S.K. et al. Histoon-modifikasies is verantwoordelik vir verminderde Fas-uitdrukking en apoptose-weerstand in fibrotiese longfibroblaste. Seldood Dis. 4, e621 (2013).

Hy, Z. et al. Epigenetiese regulering van Jou-1 geenuitdrukking deur histoonmodifikasie is betrokke by lipopolisakkaried-geïnduseerde longfibroblastproliferasie. J. Sel. Mol. Med. 17, 160–167 (2013).

Robinson, C. M., Neary, R., Levendale, A., Watson, C. J. & Baugh, J. A. Hipoksie-geïnduseerde DNA-hipermetilering in menslike pulmonêre fibroblaste word geassosieer met Thy-1-promotor-metilering en die ontwikkeling van 'n pro-fibrotiese fenotipe. Respir. Res. 13, 74 (2012).

Zong, Y. et al. Stromale epigenetiese disregulering is voldoende om muis prostaatkanker te inisieer via parakriene Wnt-sein. Proc. Natl Acad. Wetenskap. VSA 109, E3395–E3404 (2012). Hierdie studie toon dat ooruitdrukking van die chromatien hermodelleerder HMGA2 in stroma neoplasie van prostaat epiteel inisieer.

Albrengues, J. et al. Epigenetiese skakelaar dryf die omskakeling van fibroblaste in pro-invasieve kanker-geassosieerde fibroblaste. Nat. Commun. 6, 10204 (2015).

Madar, S. et al. Gemoduleerde uitdrukking van WFDC1 tydens karsinogenese en sellulêre veroudering. Karsinogenese 30, 20–27 (2009).

Orimo, A. et al. Stromale fibroblaste teenwoordig in indringende menslike borskarsinome bevorder tumorgroei en angiogenese deur verhoogde SDF-1/CXCL12 afskeiding. Sel 121, 335–348 (2005).

Olumi, A. F. et al. Karsinoom-geassosieerde fibroblaste rig tumorprogressie van geïnisieerde menslike prostaatepiteel. Kanker Res. 59, 5002–5011 (1999).

Dimanche-Boitrel, M. T. et al. In vivo en in vitro indringendheid van 'n rot kolonkanker-sellyn wat E-cadherin-uitdrukking handhaaf: 'n versterkende rol van tumor-geassosieerde miofibroblaste. Int. J. Kanker 56, 512–521 (1994).

Scherz-Shouval, R. et al. Die herprogrammering van tumorstroma deur HSF1 is 'n kragtige instaatsteller van maligniteit. Sel 158, 564–578 (2014).

Calvo, F. et al. Meganotransduksie en YAP-afhanklike matrikshermodellering is nodig vir die generering en instandhouding van kankergeassosieerde fibroblaste. Nat. Sel Biol. 15, 637–646 (2013).

Procopio, M. G. et al. Gekombineerde CSL- en p53-afregulering bevorder kankergeassosieerde fibroblastaktivering. Nat. Sel Biol. 17, 1193–1204 (2015).

Boire, A. et al. PAR1 is 'n matriks metalloprotease-1 reseptor wat inval en tumorgenese van borskankerselle bevorder. Sel 120, 303–313 (2005).

Stetler-Stevenson, W. G., Aznavoorian, S. & Liotta, L. A. Tumorselinteraksies met die ekstrasellulêre matriks tydens inval en metastase. Annu. Eerw. Cell Biol. 9, 541–573 (1993).

Sternlicht, M. D. et al. Die stromale proteïenase MMP3/stromelysin-1 bevorder melkkarsinogenese. Sel 98, 137–146 (1999).

Lochter, A. et al. Matriks metalloproteïnase stromelysin-1 veroorsaak 'n kaskade van molekulêre veranderinge wat lei tot stabiele epiteel-na-mesenchimale omskakeling en 'n premaligne fenotipe in melkepiteelselle. J. Cell Biol. 139, 1861–1872 (1997).

Borges, F. T. et al. TGF-β1-bevattende eksosome van beseerde epiteelselle aktiveer fibroblaste om weefselregeneratiewe response en fibrose te inisieer. J. Am. Soc. Nephrol. 24, 385–392 (2013).

Kahlert, C. & Kalluri, R. Eksosome in tumor mikro-omgewing beïnvloed kanker vordering en metastase. J. Mol. Med. (Berl.) 91, 431–437 (2013).

Luga, V. & Wrana, J. L. Tumor-stroma-interaksie: onthulling van fibroblast-afgeskeide eksosome as kragtige reguleerders van Wnt-planêre selpolariteitsein in kankermetastase. Kanker Res. 73, 6843–6847 (2013).

Hu, Y. et al. Fibroblast-afgeleide eksosome dra by tot chemoreweerstand deur die priming van kankerstamselle in kolorektale kanker. PLoS Een 10, e0125625 (2015).

Shimoda, M. et al. Verlies van die Timp-geenfamilie is voldoende vir die verkryging van die CAF-agtige seltoestand. Nat. Sel Biol. 16, 889–901 (2014).

Malanchi, I. et al. Interaksies tussen kankerstamselle en hul nis beheer metastatiese kolonisasie. Natuur 481, 85–89 (2012).

Vermeulen, L. et al. Wnt aktiwiteit definieer kolonkanker stamselle en word gereguleer deur die mikro-omgewing. Nat. Sel Biol. 12, 468–476 (2010).

Del Pozo Martin, Y. et al. Mesenchimale kankersel-stroma-oorspraak bevorder nisaktivering, epiteelomkering en metastatiese kolonisasie. Sel Rep. 13, 2456–2469 (2015).

Chen, W.J. et al. Kanker-geassosieerde fibroblaste reguleer die plastisiteit van longkanker-stamheid via parakriene sein. Nat. Commun. 5, 3472 (2014).

Elkabets, M. et al. Menslike gewasse veroorsaak hematopoietiese selle wat granulien uitdruk wat maligniteit bevorder deur stromale fibroblaste in muise te aktiveer. J. Clin. Belê. 121, 784–799 (2011).

Bruzzese, F. et al. Plaaslike en sistemiese protumorigeniese effekte van kanker-geassosieerde fibroblast-afgeleide GDF15. Kanker Res. 74, 3408–3417 (2014).

Levental, K. R. et al. Matriks-kruisbinding dwing tumorprogressie af deur integriensein te verbeter. Sel 139, 891–906 (2009).

Gaggioli, C. et al. Fibroblast-geleide kollektiewe inval van karsinoomselle met verskillende rolle vir RhoGTPases in leidende en volgende selle. Nat. Sel Biol. 9, 1392–1400 (2007). Hierdie artikel rapporteer ECM-hermodellering deur CAF's om spore te ontwerp wat deur kankerselle gebruik word om te migreer.

O'Connell, J.T. et al. VEGF-A en Tenascin-C geproduseer deur S100A4 + stromale selle is belangrik vir metastatiese kolonisasie. Proc. Natl Acad. Wetenskap. VSA 108, 16002–16007 (2011). Hierdie studie meld dat FSP1 + stromale selle hermodelleer die metastatiese grond.

Olaso, E. et al. Tumorafhanklike aktivering van knaagdierhepatiese stellaatselle tydens eksperimentele melanoommetastase. Hepatologie 26, 634–642 (1997).

Calon, A. et al. Afhanklikheid van kolorektale kanker op 'n TGF-β-gedrewe program in stromale selle vir metastase-inisiasie. Kankersel 22, 571–584 (2012).

Pena, C. et al. STC1 uitdrukking deur kanker-geassosieerde fibroblaste dryf metastase van kolorektale kanker. Kanker Res. 73, 1287–1297 (2013).

Kaplan, R. N. et al. VEGFR1-positiewe hematopoietiese beenmurgvoorlopers begin die pre-metastatiese nis. Natuur 438, 820–827 (2005).

Grum-Schwensen, B. et al. Onderdrukking van tumorontwikkeling en metastasevorming by muise wat nie die S100A4(mts1)-geen het nie. Kanker Res. 65, 3772–3780 (2005).

Vander Heiden, M. G., Cantley, L. C. & Thompson, C. B. Om die Warburg-effek te verstaan: die metaboliese vereistes van selproliferasie. Wetenskap 324, 1029–1033 (2009).

Martinez-Outschoorn, U. E., Lisanti, M. P. & Sotgia, F. Kataboliese kanker-geassosieerde fibroblaste dra energie en biomassa oor na anaboliese kankerselle, wat tumorgroei aanwakker. Semin. Kanker Biol. 25, 47–60 (2014).

Zhang, D. et al. Metaboliese herprogrammering van kankergeassosieerde fibroblaste deur IDH3α-afregulering. Sel Rep. 10, 1335–1348 (2015).

Chaudhri, V.K. et al. Metaboliese veranderinge in longkanker-geassosieerde fibroblaste het gekorreleer met verhoogde glikolitiese metabolisme van die gewas. Mol. Kanker Res. 11, 579–592 (2013).

Pavlides, S. et al. Die omgekeerde Warburg-effek: aërobiese glikolise in kankerverwante fibroblaste en die tumorstroma. Selsiklus 8, 3984–4001 (2009). Hierdie studie dui daarop dat Cav1 -uitklopfibroblaste werk metabolies saam met kankerselle.

LeBleu, V. S. et al. PGC-1α bemiddel mitochondriale biogenese en oksidatiewe fosforilering in kankerselle om metastase te bevorder. Nat. Sel Biol. 16, 992–1003, 1001–1015 (2014).

Ying, H. et al. Onkogene Kras onderhou pankreasgewasse deur regulering van anaboliese glukosemetabolisme. Sel 149, 656–670 (2012).

Viale, A. et al. Onkogene ablasie-weerstandige pankreaskankerselle is afhanklik van mitochondriale funksie. Natuur 514, 628–632 (2014).

Fiaschi, T. et al. Wederkerige metaboliese herprogrammering deur laktaat-pendeltuig beïnvloed die interaksie van tumor-stroma op 'n koördinerende wyse. Kanker Res. 72, 5130–5140 (2012).

Valencia, T. et al. Metaboliese herprogrammering van stromale fibroblaste deur p62-mTORC1 sein bevorder inflammasie en tumorgenese. Kankersel 26, 121–135 (2014).

Kuchnio, A. et al. Die kankersel suurstofsensor PHD2 bevorder metastase deur aktivering van kanker-geassosieerde fibroblaste. Sel Rep. 12, 992–1005 (2015).

Madsen, C. D. et al. Hipoksie en verlies van PHD2 deaktiveer stromale fibroblaste om tumorstyfheid en metastase te verminder. EMBO Rep. 16, 1394–1408 (2015).

Chang, C.H. et al. Metaboliese mededinging in die tumormikro-omgewing is 'n dryfveer van kankerprogressie. Sel 162, 1229–1241 (2015). Hierdie vraestel impliseer PDL1 in die beheer van metaboliese mededinging in die TME om T-sel hiper-responsiwiteit te bemiddel.

Ghesquiere, B., Wong, B. W., Kuchnio, A. & Carmeliet, P. Metabolisme van stromale en immuunselle in gesondheid en siekte. Natuur 511, 167–176 (2014).

Molon, B., Cali, B. & Viola, A. T. Selle en kanker: hoe metabolisme immuniteit vorm. Voorkant. Immunol. 7, 20 (2016).

Turley, S. J., Cremasco, V. & Astarita, J. L. Immunologiese kenmerke van stromale selle in die tumor-mikro-omgewing. Nat. Ds Immunol. 15, 669–682 (2015).

Lisanti, M. P., Martinez-Outschoorn, U. E. & Sotgia, F. Onkogene veroorsaak die kanker-geassosieerde fibroblast fenotipe: metaboliese simbiose en "fibroblast verslawing" is nuwe terapeutiese teikens vir dwelm ontdekking. Selsiklus 12, 2723–2732 (2013).

Costea, D.E. et al. Identifikasie van twee afsonderlike karsinoom-geassosieerde fibroblast-subtipes met differensiële tumorbevorderende vermoëns in orale plaveiselkarsinoom. Kanker Res. 73, 3888–3901 (2013).

De Boeck, A. et al. Differensiële sekretoomanalise van kankergeassosieerde fibroblaste en beenmurg-afgeleide voorlopers om mikro-omgewingsreguleerders van kolonkankerprogressie te identifiseer. Proteomika 13, 379–388 (2013).

Koczorowska, M. M. et al. Fibroblastaktiveringsproteïen-α, 'n stromale seloppervlakprotease, vorm sleutelkenmerke van kankergeassosieerde fibroblaste deur proteoom- en degradoomveranderings. Mol. Oncol. 10, 40–58 (2015).

Lotti, F. et al. Chemoterapie aktiveer kanker-geassosieerde fibroblaste om kolorektale kanker-inisierende selle te handhaaf deur IL-17A. J. Exp. Med. 210, 2851–2872 (2013).

Raffaghello, L. & Dazzi, F. Klassifikasie en biologie van tumorverwante stromale selle. Immunol. Lett. 168, 175–182 (2015).

Harper, J. & Sainson, R. C. Regulering van die anti-tumor immuunrespons deur kanker-geassosieerde fibroblaste. Semin. Kanker Biol. 25, 69–77 (2014).

Patel, R., Filer, A., Barone, F. & Buckley, C. D. Stroma: vrugbare grond vir inflammasie. Beste praktyk en navorsing. Clin. Rumatol. 28, 565–576 (2014).

Poggi, A., Musso, A., Dapino, I. & Zocchi, M. R. Meganismes van tumor ontsnap uit immuunstelsel: rol van mesenchymale stromale selle. Immunol. Lett. 159, 55–72 (2014).

Soleymaninejadian, E., Pramanik, K. & Samadian, E. Immunomodulerende eienskappe van mesenchimale stamselle: sitokiene en faktore. Am. J. Reprod. Immunol. 67, 1–8 (2012).

Park, S. J. et al. IL-6 reguleer in vivo dendritiese seldifferensiasie deur STAT3-aktivering. J. Immunol. 173, 3844–3854 (2004).

Chomarat, P., Banchereau, J., Davoust, J. & Palucka, A. K. IL-6 skakel die differensiasie van monosiete van dendritiese selle na makrofage oor. Nat. Immunol. 1, 510–514 (2000).

Hugo, H. J. et al. Bydrae van fibroblast en mastsel (afferent) en tumor (efferente) IL-6 effekte binne die tumor mikro-omgewing. Kanker Mikro-omgewing. 5, 83–93 (2012).

Wan, Y. Y. & Flavell, R. A. 'Yin-Yang' funksies van transformasie van groeifaktor-β- en T-regulerende selle in immuunregulering. Immunol. Ds. 220, 199–213 (2007).

Bailey, S.R. et al. Th17-selle in kanker: die uiteindelike identiteitskrisis. Voorkant. Immunol. 5, 276 (2014). 'n Gedetailleerde resensie oor T H. 17 selle in die TME.

Li, M. O., Wan, Y. Y., Sanjabi, S., Robertson, A. K. & Flavell, R. A. Transformerende groeifaktor-β-regulering van immuunresponse. Annu. Ds Immunol. 24, 99–146 (2006).

Kim, J.H. et al. Die rol van miofibroblaste in opregulering van S100A8 en S100A9 en die differensiasie van myeloïede selle in die kolorektale kanker mikro-omgewing. Biochem. Biofis. Res. Commun. 423, 60–66 (2012).

Augsten, M. et al. Kanker-geassosieerde fibroblaste wat CXCL14 uitdruk maak staat op NOS1-afgeleide stikstofoksied-sein vir hul tumor-ondersteunende eienskappe. Kanker Res. 74, 2999–3010 (2014).

Mishra, P., Banerjee, D. & Ben-Baruch, A.Chemokiene by die kruispad van tumor-fibroblast-interaksies wat maligniteit bevorder. J. Leukoc. Biol. 89, 31–39 (2011).

Van Linthout, S., Miteva, K. & Tschope, C. Crosstalk between fibroblasts and inflammatory cells. Kardiovask. Res. 102, 258–269 (2014).

Qian, B.Z. et al. CCL2 werf inflammatoriese monosiete om bors-tumor metastase te fasiliteer. Natuur 475, 222–225 (2011).

Silzle, T. et al. Tumor-geassosieerde fibroblaste werf bloedmonosiete in tumorweefsel. EUR. J. Immunol. 33, 1311–1320 (2003).

Barnas, J. L., Simpson-Abelson, M. R., Yokota, S. J., Kelleher, R. J. & Bankert, R. B. T-selle en stromale fibroblaste in menslike tumor-mikro-omgewings verteenwoordig potensiële terapeutiese teikens. Kanker Mikro-omgewing. 3, 29–47 (2010).

Pinchuk, I.V. et al. PD-1 ligand uitdrukking deur menslike kolon miofibroblaste/fibroblaste reguleer CD4 + T-sel aktiwiteit. Gastroënterologie 135, 1228–1237 (2008).

Nasaret, M. R. et al. Karakterisering van menslike longtumor-geassosieerde fibroblaste en hul vermoë om die aktivering van tumor-geassosieerde T-selle te moduleer. J. Immunol. 178, 5552–5562 (2007).

Augsten, M. Kanker-geassosieerde fibroblaste as 'n ander gepolariseerde sel tipe van die tumor mikro-omgewing. Voorkant. Oncol. 4, 62 (2014).

Salmon, H. et al. Matriksargitektuur definieer die voorkeurlokalisering en migrasie van T-selle na die stroma van menslike longgewasse. J. Clin. Belê. 122, 899–910 (2012).

Egeblad, M. & Werb, Z. Nuwe funksies vir die matriks metalloproteïnases in kankerprogressie. Nat. Ds Kanker 2, 161–174 (2002).

Kraman, M. et al. Onderdrukking van antitumor-immuniteit deur stromale selle wat fibroblast-aktiveringsproteïen-α uitdruk. Wetenskap 330, 827–830 (2010). Hierdie artikel toon dat die uitputting van FAP + stromale selle maak immunologiese beheer van tumorgroei moontlik.

Wen, Y. et al. Immunoterapie gerig op fibroblast-aktiveringsproteïen inhibeer tumorgroei en verhoog oorlewing in 'n muriene kolonkankermodel. Kanker Wetenskap. 101, 2325–2332 (2010).

Liao, D., Luo, Y., Markowitz, D., Xiang, R. & Reisfeld, R. A. Kanker-geassosieerde fibroblaste bevorder tumorgroei en metastase deur die tumor-immuun-mikro-omgewing in 'n 4T1 muriene borskankermodel te moduleer. PLoS Een 4, e7965 (2009).

Ohshio, Y. et al. Kanker-geassosieerde fibroblast-geteikende strategie verbeter antitumor immuunresponse in dendritiese sel-gebaseerde entstof. Kanker Wetenskap. 106, 134–142 (2015).

Rhim, A. D. et al. Stromale elemente werk om pankreas ductale adenokarsinoom te beperk, eerder as om dit te ondersteun. Kankersel 25, 735–747 (2014).

Fidler, I. J. et al. Modulasie van tumorselreaksie op chemoterapie deur die orgaanomgewing. Kanker Metastase Ds. 13, 209–222 (1994).

Farmer, P. et al. 'n Stroma-verwante geenhandtekening voorspel weerstand teen neoadjuvante chemoterapie in borskanker. Nat. Med. 15, 68–74 (2009).

Meads, M. B., Gatenby, R. A. & Dalton, W. S. Omgewing-gemedieerde middelweerstand: 'n groot bydraer tot minimale oorblywende siekte. Nat. Ds Kanker 9, 665–674 (2009). 'n Oorsig oor die rol van die TME in geneesmiddelweerstand.

Paraiso, K. H. & Smalley, K. S. Fibroblast-gemedieerde middelweerstand in kanker. Biochem. Pharmacol. 85, 1033–1041 (2013).

Heldin, C. H., Rubin, K., Pietras, K. & Ostman, A. Hoë interstisiële vloeistofdruk - 'n struikelblok in kankerterapie. Nat. Ds Kanker 4, 806–813 (2004).

Correia, A. L. & Bissell, M. J. Die tumor-mikro-omgewing is 'n dominante krag in multigeneesmiddelweerstand. Dwelmweerstand. Opdateer. 15, 39–49 (2012).

Dittmer, J. & Leyh, B. Die impak van tumorstroma op geneesmiddelreaksie in borskanker. Semin. Kanker Biol. 31, 3–15 (2015).

Mori, Y. et al. Anti-alfa4 integrien teenliggaampies onderdruk die ontwikkeling van veelvuldige myeloom en gepaardgaande osteoklastiese osteolise. Bloed 104, 2149–2154 (2004).

Park, C. C., Zhang, H. J., Yao, E. S., Park, C. J. & Bissell, M. J. β1 integrien inhibisie verhoog dramaties radioterapie doeltreffendheid in menslike borskanker xenotransplantate. Kanker Res. 68, 4398–4405 (2008).

Hazlehurst, L. A., Damiano, J. S., Buyuksal, I., Pledger, W. J. & Dalton, W. S. Adhesie aan fibronektien via β1-integrine reguleer p27kip1-vlakke en dra by tot seladhesie-gemedieerde middelweerstand (CAM-DR). Onkogen 19, 4319–4327 (2000).

White, D. E., Rayment, J. H. & Muller, W. J. Die aanspreek van die rol van seladhesie in tumorsel-dormansie. Selsiklus 5, 1756–1759 (2006).

Hirata, E. et al. Intravitale beelding onthul hoe BRAF-inhibisie dwelmverdraagsame mikro-omgewings genereer met hoë integrien β1/FAK-sein. Kankersel 27, 574–588 (2015).

Flach, E. H., Rebecca, V. W., Herlyn, M., Smalley, K. S. & Anderson, A. R. Fibroblaste dra by tot melanoom tumorgroei en middelweerstand. Mol. Farmaseut. 8, 2039–2049 (2011).

Li, G., Satyamoorthy, K. & Herlyn, M. N-Cadherin-gemedieerde intersellulêre interaksies bevorder oorlewing en migrasie van melanoomselle. Kanker Res. 61, 3819–3825 (2001).

Sui, H., Zhu, L., Deng, W. & Li, Q. Epiteel-mesenchimale oorgang en middelweerstand: rol, molekulêre meganismes en terapeutiese strategieë. Oncol. Res. Behandel. 37, 584–589 (2014).

Mitra, A., Mishra, L. & Li, S. EMT, CTCs en CSCs in tumor terugval en dwelm-weerstandigheid. Oncotarget 6, 10697–10711 (2015).

Chang, J. T. & Mani, S. A. Skape, wolf of weerwolf: kankerstamselle en die epiteel-na-mesenchimale oorgang. Kanker Lett. 341, 16–23 (2013).

Zheng, X. et al. Epiteel-na-mesenchimale oorgang is onontbeerlik vir metastase, maar veroorsaak chemoreweerstand in pankreaskanker. Natuur 527, 525–530 (2015).

Kumari, N., Dwarakanath, B. S., Das, A. & Bhatt, A. N. Rol van interleukin-6 in kankervordering en terapeutiese weerstand. Tumor Biol. http://dx.doi.org/10.1007/s13277-016-5098-7 (2016).

Wilson, T. R. et al. Wydverspreide potensiaal vir groeifaktorgedrewe weerstand teen kankerkinase-inhibeerders. Natuur 487, 505–509 (2012).

Straussman, R. et al. Tumor mikro-omgewing ontlok aangebore weerstand teen RAF inhibeerders deur HGF afskeiding. Natuur 487, 500–504 (2012).

Wang, W. et al. Kruisspraak met stromale fibroblaste veroorsaak weerstand van longkanker teen epidermale groeifaktor-reseptor-tirosienkinase-inhibeerders. Clin. Kanker Res. 15, 6630–6638 (2009).

McMillin, D. W., Negri, J. M. & Mitsiades, C. S. Die rol van tumor-stromale interaksies in die wysiging van geneesmiddelreaksie: uitdagings en geleenthede. Nat. Eerwaarde Drug Discov. 12, 217–228 (2013).

Olive, K.P. et al. Inhibisie van Egel-sein verhoog die lewering van chemoterapie in 'n muismodel van pankreaskanker. Wetenskap 324, 1457–1461 (2009).

Madden, J. I. Infinity rapporteer opdatering van fase 2-studie van saridegib plus gemcitabien by pasiënte met metastatiese pankreaskanker. Infinity Pharmaceuticals http://phx.corporate-ir.net/phoenix.zhtml?c=121941&p=irol-newsArticle&ID=1653550 (27 Januarie 2012).

Jacobetz, M. A. et al. Hyaluronan benadeel vaskulêre funksie en geneesmiddellewering in 'n muismodel van pankreaskanker. Darm 62, 112–120 (2013).

Provenzano, P.P. et al. Ensiematiese teiken van die stroma verwyder fisiese hindernisse vir die behandeling van pankreas ductale adenokarsinoom. Kankersel 21, 418–429 (2012).

Goel, S., Wong, A. H. & Jain, R. K. Vaskulêre normalisering as 'n terapeutiese strategie vir kwaadaardige en nie-kwaadaardige siektes. Koue Lente Harb. Perspektief. Med. 2, a006486 (2012).

Huang, Y., Goel, S., Duda, D. G., Fukumura, D. & Jain, R. K. Vaskulêre normalisering as 'n opkomende strategie om kanker immunoterapie te verbeter. Kanker Res. 73, 2943–2948 (2013).

Kuperwasser, C. et al. Rekonstruksie van funksioneel normale en kwaadaardige menslike borsweefsels in muise. Proc. Natl Acad. Wetenskap. VSA 101, 4966–4971 (2004).

Cheng, N. et al. Verlies van TGF-β tipe II reseptor in fibroblaste bevorder melkkarsinoom groei en indringing deur opregulering van TGF-α-, MSP- en HGF-gemedieerde seinnetwerke. Onkogen 24, 5053–5068 (2005).

Lewis, D. A., Travers, J. B., Machado, C., Somani, A. K. & Spandau, D. F. Om die verouderende stromale fenotipe om te keer, verhoed die aanvang van karsinoom. Veroudering 3, 407–416 (2011).

Paulsson, J. & Micke, P. Prognostiese relevansie van kanker-geassosieerde fibroblaste in menslike kanker. Semin. Kanker Biol. 25, 61–68 (2014).

Wang, W. Q. et al. Intratumorale α-SMA verhoog die prognostiese sterkte van CD34 wat verband hou met die handhawing van mikrovatintegriteit in hepatosellulêre karsinoom en pankreaskanker. PLoS Een 8, e71189 (2013).

Finak, G. et al. Stromale geenuitdrukking voorspel kliniese uitkoms in borskanker. Nat. Med. 14, 518–527 (2008).

Frings, O. et al. Prognostiese betekenis in borskanker van 'n geen-handtekening wat stromale PDGF-sein vasvang. Am. J. Pathol. 182, 2037–2047 (2013).

Sherman, M. H. et al. Vitamien D-reseptor-gemedieerde stromale herprogrammering onderdruk pankreatitis en verbeter pankreaskankerterapie. Sel 159, 80–93 (2014).

Takeda, Y., Tsujino, K., Kijima, T. & Kumanogoh, A. Doeltreffendheid en veiligheid van pirfenidon vir idiopatiese pulmonale fibrose. Pasiënt verkies. Nakoming 8, 361–370 (2014).

Wang, X. M., Yu, D. M., McCaughan, G. W. & Gorrell, M. D. Fibroblast aktivering proteïen verhoog apoptose, sel adhesie en migrasie deur die LX-2 menslike sterre sellyn. Hepatologie 42, 935–945 (2005).

Martinez, F. O. & Gordon, S. Die M1- en M2-paradigma van makrofaagaktivering: tyd vir herbeoordeling. F1000 Prime Rep. 6, 13 (2014).

Kim, H.Y. et al. Gelokaliseerde gladdespierdifferensiasie is noodsaaklik vir epiteel-bifurkasie tydens vertakkende morfogenese van die soogdierlong. Dev. Sel 34, 719–726 (2015).

Shyer, A. E., Huycke, T. R., Lee, C., Mahadevan, L. & Tabin, C. J. Buiggradiënte: hoe die intestinale stamsel sy tuiste kry. Sel 161, 569–580 (2015).

Selman, M. & Pardo, A. Idiopatiese pulmonêre fibrose: 'n epiteel/fibroblastiese oorspraakversteuring. Respir. Res. 3, 3 (2002).

Kalluri, R. & Weinberg, R. A. Die basiese beginsels van epiteel-mesenchimale oorgang. J. Clin. Belê. 119, 1420–1428 (2009). 'n Oorsig van EMT in ontwikkeling en patologie.

Scheel, C. & Weinberg, R. A. Kankerstamselle en epiteel-mesenchimale oorgang: konsepte en molekulêre skakels. Semin. Kanker Biol. 22, 396–403 (2012).

Jolly, M.K. et al. Om die verband tussen epiteel-mesenchimale oorgange en stamheid toe te lig. J.R. Soc. Koppelvlak 11, 20140962 (2014).

Chang, H.Y. et al. Diversiteit, topografiese differensiasie en posisionele geheue in menslike fibroblaste. Proc. Natl Acad. Wetenskap. VSA 99, 12877–12882 (2002).

Hematti, P. Mesenchymale stromale selle en fibroblaste: 'n geval van verkeerde identiteit? Sitoterapie 14, 516–521 (2012).

Dominici, M. et al. Minimale kriteria vir die definisie van multipotente mesenchimale stromale selle. Posisieverklaring van die Internasionale Vereniging vir Sellulêre Terapie. Sitoterapie 8, 315–317 (2006).

Albrengues, J. et al. LIF bemiddel pro-indringende aktivering van stromale fibroblaste in kanker. Sel Rep. 7, 1664–1678 (2014).

Avgustinova, A. et al. Tumorsel-afgeleide Wnt7a werf en aktiveer fibroblaste om gewasaggressiwiteit te bevorder. Nat. Commun. 7, 10305 (2016).

Rajaram, M., Li, J., Egeblad, M. & Powers, R. S. Stelselwye analise onthul 'n komplekse netwerk van tumor-fibroblast-interaksies wat betrokke is by tumorigenisiteit. PLoS Genet. 9, e1003789 (2013).


Wat is die werklike impak van chroniese stres op gesondheid?

Wanneer die talle sellulêre teikens van die chemiese bemiddelaars van stres in ag geneem word, sou 'n mens verwag dat uitgerekte, stres-afhanklike neuro-endokriene disregulering feitlik alle organe en weefsels direk of deur funksionele stroombane kan beskadig. Om hierdie aanname te verduidelik en die biochemiese weë wat aansienlik benadeel word deur chroniese stres tot die mate van siekte te identifiseer, het navorsers aan die een kant gesoek na vermoedelike morfologiese weefselveranderinge wat met stres geassosieer word, en andersyds die molekulêre meganismes van werking van die hoofstres ontleed. hormone.

Effekte van chroniese stres op breinstruktuur

Daar is getoon dat chroniese stres gekoppel is aan makroskopiese veranderinge in sekere breinareas, wat bestaan ​​uit volume variasies en fisiese modifikasies van neuronale netwerke. Byvoorbeeld, verskeie studies in diere het stresverwante effekte in die prefrontale korteks (PFC) en limbiese stelsel beskryf, gekenmerk deur volumeverminderings van sommige strukture, en veranderinge in neuronale plastisiteit as gevolg van dendritiese atrofie en verminderde ruggraatdigtheid [4]. Hierdie morfologiese veranderinge is soortgelyk aan dié wat gevind word in die brein van depressiewe pasiënte wat nadoodse ondersoek is, wat daarop dui dat hulle ook aan die basis kan wees van die depressiewe versteurings wat dikwels met chroniese stres by mense geassosieer word. Hierdie hipotese word ondersteun deur beeldstudies wat strukturele veranderinge in die brein van individue wat aan verskeie tipes stresverwante versteurings ly, getoon het, soos dié wat verband hou met ernstige traumas, groot negatiewe lewensgebeure of chroniese psigososiale spanning. In die besonder het Blix en kollegas atrofie van die basale ganglia waargeneem en grysstof in sekere areas van die PFC aansienlik verminder in vakke wat met langtermyn beroepstres ly [5]. Oor die algemeen kan die gevolge van hierdie veranderinge in 'n breinstreek uitbrei na ander funksioneel gekoppelde areas, en moontlik daardie kognitiewe, emosionele en gedragsdisfunksies veroorsaak wat algemeen met chroniese stres geassosieer word, en wat kwesbaarheid vir psigiatriese versteurings kan verhoog.

Interskakel tussen die brein & # x00026 die immuunstelsel

Die begrip van die molekulêre stroombane wat onderliggend is aan argitektoniese veranderinge in die brein en mediese toestande wat aan chroniese stres gekoppel is, is net aan die begin. Navorsing in hierdie area het hoofsaaklik gesentreer op die seinfunksies van daardie molekules wat direk deur stres geïnduseer word deur die aktivering van die simpatiese-adrenale-medullêre en HPA-netwerke, met die fokus op hul moontlike sellulêre teikens. Aangesien reseptore vir stresneuropaptiede en -hormone breedweg in immuunselle uitgedruk word [6], het die meeste studies gekonsentreer op die uitwerking van stres op die immuunstelsel (IS). Trouens, sielkundige stres kan die akute fase-reaksie veroorsaak wat algemeen met infeksies en weefselskade geassosieer word, en die vlakke van sirkulerende sitokiene en verskeie biomerkers van inflammasie verhoog [2]. Soos voorgestel deur Maier en Watkins, kan die interskakel tussen die stresreaksie en inflammasie wat deur die IS ontlok word vanuit die evolusionêre perspektief verduidelik word deur in ag te neem dat die stresreaksie 'n aanpassingsproses is wat ontwikkel is deur die IS-meganismes van verdediging te koöpteer [7]. In hierdie raamwerk bring 'n sielkundige stressor, wat deur die brein as �nger’ waargeneem word, dit wil sê potensieel skadelik, 'n neuro-immuunkring aan die gang wat die IS stimuleer om 'n beskermende reaksie op te stel wat bedoel is om skade te voorkom, dit te herstel en homeostase te herstel .

Hierdie neuro-immuun kommunikasie is tweerigting omdat die sitokiene wat deur stres-gestimuleerde immuunselle geproduseer word, ook 'n terugvoer na die senuweestelsel oordra, wat die vrystelling van streshormone in die brein verder moduleer, asook breinaktiwiteit wat gedrag en kognitiewe funksies reguleer. In 'n situasie van chroniese stres kan die neuro-immuun-as oorgestimuleer word en afbreek, wat sodoende neuro-endokriene/immuun-wanbalanse veroorsaak wat 'n toestand van chroniese laegraadse inflammasie vestig, 'n moontlike voorspel tot verskeie siektes [8].

Siektes waarvan die ontwikkeling aan beide stres en inflammasie gekoppel is, sluit in kardiovaskulêre disfunksies, diabetes, kanker, outo-immuun sindrome en geestesiektes soos depressie en angsversteurings.

Aanhoudende, abnormale vlakke van sitokiene en stres-chemiese mediators in die brein kan ook die parenchiem beskadig en neuronale dood veroorsaak, en sodoende bydra tot die breinstrukturele veranderinge wat verband hou met chroniese stres wat hierbo beskryf word [9].

Ten spyte van die groot aantal studies wat die biologiese effekte van chroniese stres en die impak daarvan op menslike gesondheid aangespreek het, skets die ontluikende prentjie steeds net die biochemiese en funksionele reaksies van die senuwee- en immuunstelsels op langtermyn stres, en beklemtoon sommige nodusse van inligting uitruiling tussen die twee netwerke, maar ontbreek steeds noodsaaklike elemente rakende bykomende sellulêre spelers, en funksionele en molekulêre meganismes.

Sommige onlangse studies het egter ons kennis van hoe chroniese stres twee van die siektes wat lank daarmee geassosieer word, aansienlik verbeter: aterosklerose en depressie.

Effekte van chroniese stres op hematopoietiese stamselle in kardiovaskulêre siektes

Heidt en kollegas het gedemonstreer hoe stres die vlakke van sirkulerende inflammatoriese leukosiete verhoog deur direkte stimulasie van hematopoietiese stamselproliferasie [10]. In hierdie nuwe pad veroorsaak stres die vrystelling van noradrenalien deur simpatiese senuweevesels wat bloedvate in die beenmurg van muise teiken. Die katekolamien werk dan op mesenchimale stamselle wat in die hematopoietiese nis geleë is, wat hoë vlakke van die 㬣 adrenergiese reseptore uitdruk. Een van die gevolge van hierdie interaksie is die afregulering van die chemokien CXCL12, 'n bekende teiken van noradrenalien, wat normaalweg deur verskeie tipes nisselle geproduseer word, insluitend mesenchimale stamselle. Dit stel die inhibisie vry wat tipies deur CXCL12 uitgeoefen word op die proliferasie van hematopoietiese stam- en stamselle en op leukosietmigrasie, en bevorder dus seldeling en leukosietmobilisasie in die bloedstroom.

Voorspelbaar kan die inflammatoriese reaksie wat veroorsaak word deur die aktivering van hierdie neuro-immuunweg nadelige gesondheidseffekte hê, veral deur voorafbestaande mediese toestande te vererger. Spesifiek, die studie het getoon dat hierdie meganisme geaktiveer is wanneer aterosklerose-geneigde muise ApoE -/- aan langtermyn stres onderwerp is, wat gelei het tot verbeterde werwing van inflammatoriese selle in aterosklerotiese gedenkplate, hoër vlakke van proteases en verhoogde plaakbroosheid. Die interessantste is dat 㬣-adrenergiese reseptorblokkeerders leukosietproduksie en mobilisering teengestaan ​​het, en sodoende plaakontsteking teëgewerk.

Toe hulle hul aandag na menslike proefpersone verskuif het, het die wetenskaplikes vasgestel dat individue onder aansienlike beroepstres aansienlik meer sirkulerende leukosiete gehad het in vergelyking met wanneer hulle nie gewerk het nie, wat daarop dui dat die neuro-immuunmeganisme wat hulle ontdek het moontlik deur chroniese stres veroorsaak kan word en 'n inflammatoriese reaksie kan onderhou. in mense. As dit gedemonstreer word, sal dit die weg oopmaak vir konseptueel nuwe terapeutiese moontlikhede, nie net vir aterosklerose en die verwante komplikasies nie, maar ook vir ander stresverwante siektes wat deur chroniese inflammasie vererger word.

Meganismes van chroniese stres-geassosieerde depressie & brein–skeletspier kommunikasie

Die meganismes waardeur streschemikalieë depressie kan veroorsaak, is meestal onbepaald. Navorsing in hierdie veld begin om te definieer hoe veelvuldige, onafhanklike, hoewel dikwels onderling gekoppelde biochemiese weë wat deur chroniese stres geraak word, saamstem om hierdie siekte te bevorder.

Ota en kollegas het 'n molekulêre meganisme geïdentifiseer wat veroorsaak word deur chroniese stres wat bydra tot neuronale atrofie in spesifieke breinareas, 'n anomalie wat tipies waargeneem word by depressiewe pasiënte, onafhanklik van die oorsaak van depressie [11]. In hul studie het hulle waargeneem dat aanhoudende hoë vlakke van GC's, as gevolg van stresgeïnduseerde hiperaktivering van die HPA-as, die produksie van die molekule REDD1 in die PFC van knaagdiere wat aan langdurige stres onderwerp word, stimuleer.REDD1 word oor die algemeen geïnduseer deur 'n verskeidenheid stressors – van energiestres, tot hipoksie, tot DNA-skade – in die meeste weefsels en inhibeer die kinase mTORC1, en verander dus die fosforileringstoestand en funksie van sy teikens. In die brein beïnvloed die inmenging van REDD1 met mTORC1-sein uiteindelik neuronale proteïensintese, ruggraatvorming en sinaptiese plastisiteit. Die inhibisie van mTORC is deurslaggewend vir sinaptiese inkorting en blyk 'n sentrale eindpunt te wees van molekulêre weë wat deur chroniese stres aangeskakel word. Trouens, ook die afname van brein-afgeleide neurotrofiese faktorvlakke in reaksie op chroniese stres ontwrig mTORC1-funksie.

Pro-inflammatoriese sitokiene wat deur stres geïnduseer word, is ook betrokke by die ontwikkeling van chroniese stresverwante depressie [12]. Die akute fase-reaksie wat gewoonlik deur 'n skadelike faktor veroorsaak word, impliseer die sogenaamde siektegedrag wat simptome insluit soortgelyk aan dié tipies van depressiewe versteurings, soos sosiale onttrekking, verminderde fisiese aktiwiteit, moegheid, slaperigheid, bui en kognitiewe veranderinge. Hierdie aanpasbare reaksie word deur sitokiene georkestreer, en is bedoel om 'n individu van normale aktiwiteite af te lei om energie te bespaar, en sodoende 'n reaksie teen die uitdaging en daaropvolgende herstel te fasiliteer. In die geval van chroniese inflammasie wat met langdurige stres kan intree, verhoed aanhoudende sitokiensein in die brein die oplossing van siektegedrag wat gevolglik in depressie kan ontaard. Die biochemiese meganismes onderliggend aan sitokien-geïnduseerde depressie is nie goed gedefinieer nie, maar dit kan veranderinge van serotonien en glutamatergiese oordrag behels, en induksie van GC-weerstand [12].

Een van die weë wat geïmpliseer word, dryf die oksidasie van triptofaan ('n voorloper van serotonien) na Kynurenin (Kyn) en lei tot die breinproduksie van verskeie neuroaktiewe molekules (Figuur 1) [12]. Die ensieme triptofaan 2,3-dioksigenase en indoleamien 2,3-dioksigenase aktiveer die Kyn-baan onderskeidelik in die lewer en ekstrahepaties, en kan beide deur chroniese stres geaktiveer word: triptofaan 2,3-dioksigenase reageer in werklikheid op GC's, terwyl indolamien 2 ,3-dioksigenase word deur pro-inflammatoriese sitokiene geïnduseer. Die Kyn-pad beïnvloed nie net die breinvlakke van serotonien en dus serotonergiese oordrag en die bui en gedragseffekte daarvan nie, maar dit is ook verantwoordelik vir die produksie van triptofaanmetaboliete wat neuro-inflammatoriese eienskappe het of glutamatergiese neurotransmissie in die brein hetsy positief of negatief kan beïnvloed. Dit volg dat 'n verskuiwing in die pad wat die produksie van 3-hydroxykynurenine bevoordeel – 'n induseerder van reaktiewe suurstofspesies en inflammasie – en kinoliensuur – 'n N-metiel-d-aspartaat reseptor agonis – oor die antioksidant en N-metiel-d-aspartaat reseptor inhibeerder kynurensuur, kan depressie bevorder [12].

Daar is bewyse dat fisiese oefening breingesondheid kan onderhou deur die produksie van neurotrofiese faktore, neuro-oordragstowwe, sowel as inflammatoriese molekules te reguleer. Dit kan vertaal word in 'n algemene verbetering van kognitiewe vermoëns, 'n verminderde risiko van neurodegeneratiewe siektes en 'n versagting van depressie [13].

'n Interessante studie het onlangs getoon dat 'n sleutelmeganisme waardeur fisiese oefening chroniese stres-afhanklike depressie teëwerk, die modulasie van die Kyn-weg van triptofaan-afbraak is [14]. In hierdie werk het Agudelo en kollegas gedemonstreer dat skeletspiersametrekking tydens uitgerekte oefening plaaslik die interaksie van die transkripsionele koaktiveerder PGC-1㬑 met die transkripsiefaktore PPARα/δ veroorsaak, en sodoende die uitdrukking en aktiwiteit van die spiere verhoog. 'n stel kynurenien-aminotransferases (KAT). KAT's kataliseer die perifere transformasie van triptofaan-afgeleide Kyn in kynurensuur, wat 'n daling in die vlakke van sirkulerende Kyn veroorsaak. Aangesien Kyn die bloedbreinversperring kan oorsteek, het sy perifere katabolisme die effek om ook sy breinkonsentrasie te verminder en dus die produksie van neurotoksiese molekules langs die 3-hidroksikynurenien en kinoliensuurtak van die afbraakpad. In muise, onder toestande wat chroniese stres naboots, voorkom die ooruitdrukking in skeletspiere van PGC-1㬑 neuro-inflammasie, sinaps-inkorting en depressie-agtige gedrag wat eerder in beheerdiere waargeneem word. Net so het die wetenskaplikes bevind dat oefenopleiding die PGC-1㬑-KAT-baan ook by mense stimuleer, en deur hierdie meganisme potensieel daardie Kyn-afhanklike toksiese effekte in die brein reguleer wat bydra tot chroniese stres-geassosieerde depressie.

Deur nuwe seinkaskades te identifiseer wat geïmpliseer is in die regulering van depressie wat deur chroniese stres veroorsaak word, stel Ota en Agudelo se studies nuwe areas van ondersoek vir terapie-ontwikkeling voor. Middels wat REDD1-effekte op mTORC1 inhibeer, of wat breinvlakke van Kyn moduleer deur sy perifere metabolisme te verbeter, kan die behandeling van depressie verbeter, miskien ook wanneer dit nie stresverwant is nie. Aangesien depressiewe individue gewoonlik huiwerig is om gereelde fisiese oefening uit te voer, sal dwelms wat oefenopleiding naboots en die plasmakonsentrasie van Kyn verminder deur perifeer op te tree van besondere belang wees.

Biologiese & sosiale implikasies van die jongste bevindinge in chroniese stres navorsing

Hierdie studies verbeter aansienlik ons ​​begrip van die interaksies tussen die senuweestelsels en perifere weefsels en organe, en hoe hul veranderinge siekte kan veroorsaak (Figuur 2). 'n Belangrike ontdekking is dat as chroniese stres aan die een kant immuundisfunksies kan veroorsaak, dit wil sê, 'n perifere funksie benadeel, aan die ander kant kan behoorlike stimulasie van 'n perifere weefsel soos skeletspiere stresimptome verlig en die brein beskerm, wat moontlik herstel kan bevoordeel. Dit dui daarop dat programme van fisiese oefening formeel voorgestel moet word as 'n voorkomende maatreël aan mense wat bekend is dat hulle aan intense stres blootgestel word (bv. werkverwante stres), en kan voorgeskryf word as 'n vorm van terapie in kombinasie met ander behandelings om te verlig. bui en kognitiewe agterstande wat deur chroniese stres veroorsaak word.

Daarbenewens dui Heidt se studie op 'n ander interessante moontlikheid: as chroniese stres hematopoietiese stam- en stamselle kan stimuleer deur die aktivering van die perifere senuweestelsel, is dit aanneemlik dat dit ook ander tipes stamselle in ander weefsels kan aktiveer deur 'n soortgelyke meganisme. Tweerigting kommunikasie kan in beginsel bestaan ​​tussen die senuweestelsel en elke orgaan en weefsel, en verteenwoordig 'n algemene meganisme van senuweebeheer van weefselhomeostase. 'n Paar onlangse studies het bewyse gelewer wat hierdie hipotese ondersteun [15�]. Een van die gevolglike en uitlokkende implikasies is dat chroniese stres kankerontwikkeling kan bevorder ook deur direkte induksie van onbeheerde selproliferasie.

Die erkenning dat chroniese stres ernstige siektes kan veroorsaak, het navorsing verskerp om die biochemiese versteurings te bepaal wat homeostase benadeel tot 'n mate wat spontane herstel verhoed. Die prentjie is baie kompleks omdat chroniese stres blykbaar orgaan- en sisteemfunksies op verskeie vlakke beïnvloed. Tog is dit deur spesifieke biochemiese prosesse wat deur chroniese stres geraak word vas te stel dat dit moontlik sal wees om oplossings in die vooruitsig te stel om veerkragtigheid te stimuleer en stres-afhanklike siektes te beheer.

Dit is duidelik dat in die geval van siektes wat veroorsaak word deur verhoogde beroepstres, voorkeur gegee moet word aan voorkomende intervensies met die doel om werksomstandighede te skep en in stand te hou met respek vir menslike fisiologiese, emosionele en sosiale behoeftes: met ander woorde, die werksomgewing moet stimuleer groei en produktiwiteit terwyl elke individu in hul uitdagings ondersteun word. As sekere maatreëls geïmplementeer kan word deur amptelike regulasies wat byvoorbeeld billike kontrakte, opleiding en sinvolle werkskedules verseker met betrekking tot die tipe en las van verantwoordelikhede en die vlakke van fisiese en geestelike betrokkenheid wat deur die werk geïmpliseer word, is ander minder hanteerbaar omdat hulle streng afhanklik is van menslike faktore. Elemente soos teenstrydige interaksies met kollegas en meerderes se eise buite formele ooreenkomste, wat redelik algemeen in baie mededingende werksomgewings voorkom, kan spanning verskerp en die psigososiale spanning oordryf tot die punt dat dit siekte veroorsaak, maar hulle bly gewoonlik oor die hoof gesien en onbeheersd [17] .


UG Legon Minimum Vereistes Vir Voorgraadse Baccalaureusprogramme

Ghana WASSCE/SSSCE

Die Universiteit van Ghana kondig vir die inligting van die algemene publiek aan die minimum vereistes is vir die toelating van voornemende aansoekers tot verskeie voorgraadse programme vir die akademiese jaar. Aansoekers moet kennis neem van die volgende minimum voorgraadse programme vir die akademiese jaar voordat hulle aansoek doen om toelating:

GHANA WASSCE/SSSCE & # 8211 Minimum/Algemene Inskrywing

Minimum Toelatingsvereistes na Legon-kampus, Accra City-kampus en Korle Bu-kampus.

'n Aansoeker vir toelating tot 'n graadprogram aan die Universiteit van Ghana moet ten minste hê

  1. krediete (A1 – C6 in WASSCE en A – D in SSSCE) in Engels, Kernwiskunde en Geïntegreerde Wetenskap (vir Wetenskapverwante programme) of Sosiale Studies (vir nie-wetenskapverwante programme) en drie keusevakke in Wetenskap vir aansoekers wat aansoek doen na Wetenskap- of Landbouverwante dissiplines of drie keusevakke in Algemene Kunste/Besigheid vir aansoekers wat aansoek doen vir nie-wetenskapverwante dissiplines, met die totale totaal wat nie 24 oorskry nie.
  2. Daarbenewens moet Wetenskap-aansoekers ten minste 'n graad C6 in WASSCE/D in SSSCE in Sosiale Studies/Lewensvaardighede hê en nie-wetenskap-aansoekers moet ook ten minste 'n graad C6 in WASSCE/D IN SSSCE in Geïntegreerde Wetenskap/Kernwetenskap hê.

HOLLEGE VIR GESONDHEIDSWETENSKAPPE

Ghana WASSCE/SSSCE Aansoekers

Aansoekers op die kortlys vir programme by die Kollege vir Gesondheidswetenskappe:

Toelatingsvereistes vir die Universiteit van Ghana Mediese Skool

Minimum Toelating Vereistes Vir Baccalaureus in Geneeskunde en Baccalaureus in Chirurgie

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies
Keusevakke: Krediet slaag in Chemie en enige twee van Fisika, Biologie en Keuse Wiskunde

Toelatingsvereistes vir Tandheelkundige Skool van die Universiteit van Ghana

Minimum Toelating Vereistes Vir Baccalaureus in Tandheelkundige Chirurgie

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies
Keusevakke: Krediet slaag in Chemie en enige twee van Fisika, Biologie en Keuse Wiskunde

Toelatingsvereistes vir Skool vir Farmasie

Minimum Toelating Vereistes Vir doktor in farmasie

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in Chemie, Biologie en óf Fisika óf Keuse Wiskunde

Toelatingsvereistes vir Skool vir Biologiese & Geallieerde Gesondheidswetenskappe

Minimum Vereistes Vir Baccalaureus Scientiae in Dieetkunde, Mediese Laboratorium, Arbeidsterapie, Fisioterapie, Radiografie, Respiratoriese Terapie.

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Kredietslaag in Chemie, Fisika en Biologie of Keuse Wiskunde

Toelatingsvereistes vir Skool vir Verpleegkunde en Verloskunde

Minimum vereistes vir Baccalaureus Scientiae in Verpleegkunde met opsies in:

Daar word van aansoekers verwag om een ​​(1) opsie te kies

    1. Algemene Verpleegkunde
    2. Gemeenskapsgesondheidsverpleegkunde
    3. Pediatriese Verpleegkunde
    4. Geestesgesondheidsverpleegkunde

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies.

Keusevakke: Krediet slaag in drie keusevakke uit enige van die kombinasies hieronder:

Chemie, Fisika, Biologie of elektiewe Wiskunde

Algemene Landbou, Fisika en Chemie

Drie Algemene Kunste-keusevakke

Twee Algemene Kunste-keusevakke plus Voedsel en Voeding

Enige drie van die volgende keusevakke: Ekonomie, Bestuur in Lewe, Voedsel en Voeding, Chemie, Algemene Kunskennis en Frans.

Minimum vereistes vir Baccalaureus Scientiae in Verloskunde

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in drie keusevakke uit enige van die kombinasies hieronder:

  1. Chemie, Fisika, Biologie of elektiewe Wiskunde
  2. Algemene Landbou, Fisika en Chemie
  3. Drie Algemene Kunste-keusevakke
  4. Twee Algemene Kunste-keusevakke plus Voedsel en Voeding
  5. Enige drie van die volgende keusevakke: Ekonomie, Bestuur in Lewe, Voedsel en Voeding, Chemie, Algemene Kunskennis en Frans.

KOLLEGE VIR BASIESE EN TOEGEPASTE WETENSKAPPE GHANA WASSCE/SSSCE AANSOEKERS

Let daarop dat die volgende programme by die Kollege vir Basiese en Toegepaste Wetenskappe EERSTEKEUSE-programme is:

Doktor in Veeartsenykunde, Baccalaureus Scientiae in Inligtingstegnologie, Baccalaureus Scientiae in Rekenaaringenieurswese en Baccalaureus Scientiae in Biomediese Ingenieurswese.

Toelatingsvereistes vir Skool vir Fisiese en Wiskundige Wetenskappe

Minimum Vereistes Vir Baccalaureus Scientiae in Fisiese Wetenskappe (Fisika, Chemie, Geofisika)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie en Keuse Wiskunde, met ten minste 'n B3 in Keuse Wiskunde

Minimum Vereistes Vir Baccalaureus Scientiae in Wiskundige Wetenskappe (Wiskunde, Statistiek, Aktuariële Wetenskap, Rekenaarwetenskap, Biowiskunde, Fisika)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies.

Keusevakke: Krediet slaag in enige drie vakke met ten minste a B2 in Keuse Wiskunde.

Minimum Vereistes Vir Baccalaureus Scientiae in Aardwetenskappe (Geologie, Toegepaste Geologie, Toegepaste Geofisika)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie/Aardrykskunde en Keuse Wiskunde, met ten minste 'n C6 in Chemie

Minimum Vereistes Vir Baccalaureus Scientiae in Inligtingstegnologie

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie vakke, met ten minste 'n B2 in Kernwiskunde.

Toelatingsvereistes vir Skool vir Biologiese Wetenskappe

Minimum vereistes vir Baccalaureus Scientiae in Biologiese Wetenskappe (Dierebiologie en Bewaringswetenskap, Biochemie Sel- en Molekulêre Biologie, Voeding, Voedselwetenskap, Plant- en Omgewingsbiologie, Mariene Wetenskap, Visserywetenskap, Mikrobiologie)

Kern: Krediet slaag in Engels, Kern Wiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie en Keuse Wiskunde, met ten minste 'n C6 in Chemie

Minimum Vereistes Baccalaureus Scientiae in Sielkunde

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie en Keuse Wiskunde

Toelatingsvereistes vir Landbouskool

Minimum Vereistes Baccalaureus Scientiae in Landbou ( Veekunde, Gewaskunde, Grondkunde, Landbou-ekonomie, Agribesigheid, Landbou-uitbreiding, Na-oestegnologie )

Kern: Krediet slaag in Engels, Kern Wiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Kredietslaag in enige drie van Chemie, Fisika, Biologie/Landbouwetenskap, Geografie en Keusewiskunde, met ten minste 'n C6 in Chemie

Minimum vereistes vir Baccalaureus Scientiae in Gesins- en Verbruikerswetenskappe (Kos en Klere)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie vakke met ten minste a C6 in Chemie

Minimum vereistes vir Baccalaureus Scientiae in Gesins- en Verbruikerswetenskappe (Gesins- en Kinderstudies)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke van:

  • Wetenskap
  • Algemene Kunste (behalwe Tale en Visuele Kunste)
  • Huishoudkunde/Wetenskap (Krediet slaag in Bestuur in Lewe en enige twee van Voedsel en Voeding, Tekstiel en Klere, Algemene Kennis in Kuns, Biologie of Chemie.

Toelatingsvereistes vir Skool vir Ingenieurswetenskappe

Minimum Vereistes Vir Baccalaureus Scientiae in Landbou-ingenieurswese

Kern: Krediet slaag in Engels, Kern Wiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie en Keuse Wiskunde, met ten minste 'n B3 in Keuse Wiskunde

Minimum Vereistes Vir Baccalaureus Scientiae in Biomediese Ingenieurswese

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies.

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie en Keuse Wiskunde, met ten minste 'n B3 in Keuse Wiskunde

Minimum vereistes vir Baccalaureus Scientiae in Rekenaaringenieurswese

Kern: Krediet slaag in Engels, Kern Wiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie en Keuse Wiskunde, met ten minste 'n B3 in Keuse Wiskunde

Minimum vereistes vir Baccalaureus Scientiae in Voedselverwerkingsingenieurswese

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie en Keuse Wiskunde, met ten minste 'n B3 in Keuse Wiskunde

Minimum vereistes vir Baccalaureus Scientiae in Materiaalwetenskap-ingenieurswese

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie en Keuse Wiskunde, met ten minste 'n B3 in Keuse Wiskunde

Toelatingsvereistes vir Skool vir Veeartsenykunde

Minimum Vereistes Vir Dokter in Veeartsenykunde

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie van Fisika, Chemie, Biologie en Keuse Wiskunde, met ten minste 'n C6 in beide Biologie en Chemie

HOLLEGE VIR GEESTESWETENSKAPPE

GHANA WASSCE/SSSCE AANSOEKERS

Toelatingsvereistes vir Skool vir Sosiale Wetenskappe/ Skool vir Kuns/ Skool vir Tale

Minimum vereistes vir Baccalaureus Artium

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke

Aansoekers moet die volgende WASSCE-vakke hê om te kwalifiseer om die ondergenoemde kursusse te lees:

  • Ekonomie, Wiskunde of Statistiek & # 8211 Keuse Wiskunde
  • Rekenaarwetenskap & # 8211 Keuse Wiskunde
  • Frans & # 8211 Frans
  • Engelse & # 8211 Engelse Letterkunde
  • Aardrykskunde Aardrykskunde

Toelatingsvereistes vir die Universiteit van Ghana Business School

Minimum Vereistes Vir Baccalaureus Scientiae in Besigheidsadministrasie

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke

Toelatingsvereistes vir die Universiteit van Ghana Skool vir Regte

Minimum vereistes vir Baccalaureus in Regte (LLB)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke

Toelatingsvereistes vir Skool vir Uitvoerende Kunste

Minimum vereistes vir Baccalaureus in Beeldende Kunste

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke.

Die program is oop vir aansoekers wat belangstel in die Uitvoerende Kunste met 'n totaal van 24 of beter. Daar sal van hulle verwag word om 'n oudisie of onderhoud by te woon.

OPVOEDKOLLEGE

GHANA WASSCE/SSSCE AANSOEKERS

Toelatingsvereistes vir Skool vir Onderwys en Leierskap

Minimum vereistes vir BA Onderwys (Engels)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke, insluitend Engelse letterkunde.

Minimum vereistes vir BA Onderwys (Nie-onderrig)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke.

Minimum vereistes vir BA Sport en Fisiese Kultuurstudies

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke

Minimum Vereistes Vir B.Sc. Onderwys (Wiskunde)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in Keuse Wiskunde en enige ander twee keusevakke

Minimum Vereistes Vir B.Sc. Onderwys (Biologie)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Kredietslaag in Biologie en enige ander twee keusevakke

Minimum Vereistes Vir B.Sc. Onderwys (Chemie)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Kredietslaag in Chemie en enige ander twee keusevakke

Minimum Vereistes Vir B.Sc. Onderwys (Fisika)

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Kredietslaag in Fisika en enige ander twee keusevakke

Toelatingsvereistes vir Skool vir Voortgesette & Afstandsonderrig

Minimum vereistes vir Baccalaureus Scientiae in Besigheidsadministrasie

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke met die totale totaal wat nie 24 oorskry nie

Minimum vereistes vir Baccalaureus Artium

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke met die totale totaal nie meer as 30 nie

Minimum Vereistes Vir Baccalaureus Scientiae in Inligtingstegnologie

Kern: Kredietslaag in Engels, Kernwiskunde, Geïntegreerde Wetenskap en Sosiale Studies

Keusevakke: Krediet slaag in enige drie keusevakke met die totale totaal wat nie 30 oorskry nie

Minimum vereistes vir Baccalaureus Scientiae in Verpleegkunde

Aansoekers moet professionele verpleegkundiges wees wat reeds 'n Diploma in Verpleegkunde van 'n erkende Verpleegopleidingskollege het, met 'n finale graadpuntgemiddelde (FGPA) VAN 2.5 of beter.

Alle belangstellende aansoekers kan by enige van die Leersentrums van die Skool vir Voortgesette en Afstandsonderrig hieronder registreer, na betaling in die volgende rekening: Rekening Naam en nommer: (UG Leersentrum A/C, ECOBANK. A/C Nommer 0160134485305902).

Alle belangstellende aansoekers kan by enige van die Rekeningkantore van die Skool vir Voortgesette Onderwys en Afstandsonderrig hieronder registreer, na betaling in die volgende rekening: Rekening Naam en nommer: Onderwyskollege, ECOBANK. A/C NOMMER 0160094485305901.


Voldoende buitelugventilasie kan die vermoë verbeter om uit te voer, toetstellings te verhoog en die oordrag van infeksie in die lug te verminder

Ventilasiekoerse in die meeste skole is onder die aanbevole vlakke. 8 Toenemende bewyse van die positiewe impak van buitelugventilasie dui op 'n duidelike geleentheid vir die verbetering van gesondheid en akademiese prestasie.

Vermoë om te presteer

  • Studies toon 'n verband tussen verbeterings in IAQ - hetsy van verhoogde buitelugventilasietempo's of van die verwydering van besoedelingsbronne - en verbeterde prestasie van kinders en volwassenes. 39, 70, 69, 31, 56, 3
  • Gekontroleerde studies toon dat kinders skoolwerk met groter spoed verrig namate ventilasietempo's toeneem.
  • Daar is ook getoon dat die prestasie van volwassenes, insluitend onderwysers en skoolpersoneel, verbeter met hoër ventilasietempo's. 77, 78

Toetstellings

Kinders in klaskamers met hoër buitelugventilasietempo's is geneig om hoër tellings op gestandaardiseerde toetse in wiskunde en lees te behaal as kinders in swak geventileerde klaskamers. 57

Oordrag van infeksie

Hoër ventilasietempo's verminder die oordrag en verspreiding van aansteeklike middels in geboue. Dit is die gevolgtrekking van 'n multidissiplinêre kundige paneel nadat 40 studies wat tussen 1960 en 2005 uitgevoer is, nagegaan is.

  • In hul verslag beveel die skrywers aan dat skole en soortgelyke hoëdigtheidfasiliteite hul ventilasietempo's tydens griep-piekseisoen verhoog. 28
  • Daarbenewens het 'n gekontroleerde studie in kantoorgeboue 'n verband gevind tussen korttermyn-siekverlof, wat dikwels met respiratoriese siektes geassosieer word, en lae ventilasiekoerse. 37
  • Bewoners van geboue met lae ventilasietempo en hoë bewonerdigtheid het veel hoër koerse van respiratoriese siektes ervaar as die inwoners van soortgelyke geboue met hoër ventilasietempo's. 56

15.16: Fisiese Bewyse - Biologie

Fisiese funksie (dws aërobiese kapasiteit, loopspoed en spierkrag) is voorgestel as 'n biomerker van gesonde veroudering, aangesien dit voorspellend is vir nadelige gesondheidsgevalle, gestremdheid en mortaliteit. Die rol van fisiese oefening as 'n terapeutiese strategie vir die voorkoming van beide siekte en die gepaardgaande afname in funksionele kapasiteit is herhaaldelik beklemtoon. Oefenintervensies onder toesig in gehospitaliseerde ouer mense (ouderdom ≥75 jaar) is bewys dat dit veilig en effektief is om funksionele en kognitiewe agteruitgang te voorkom of te verswak. Ongelukkig het min studies die potensiële rol van pasgemaakte fisieke aktiwiteitsriglyne ondersoek om oefeningverwante effek op funksie te maksimeer. Oefening is ook nie ten volle geïntegreer in primêre of geriatriese mediese praktyk nie en is amper afwesig in die kernopleiding van die meeste mediese dokters en ander gesondheidsorgverskaffers. Fisiese afrigters moet by gesondheidsorgstelsels ingesluit word om te help om fisiese oefenprogramme vir ouer pasiënte te bestuur. Met inagneming van huidige bewyse oor die voordele van oefening vir verswakte ouer volwassenes, is dit oneties om nie fisiese oefening vir sulke individue voor te skryf nie. Om gesonde en waardige veroudering te bevorder, is dit dus noodsaaklik om gesondheidsorgstelsels te help om bewysgebaseerde oefenprogramme vir verswakte ouer volwassenes in alle gemeenskaps- en sorginstellings meer doeltreffend te implementeer.


Matige‐tot‐ Kragtige Fisiese Aktiwiteit en Alle Oorsake Mortaliteit: Maak aanvalle saak?

Die 2008 Fisiese Aktiwiteitsriglyne vir Amerikaners beveel aan dat volwassenes matige tot kragtige fisiese aktiwiteit (MVPA) in periodes van ≥10 minute ophoop vir aansienlike gesondheidsvoordele. In watter mate dieselfde hoeveelheid MVPA opgehoop in aanvalle versus die sterfterisiko sporadies verminder, bly onduidelik.

Metodes en resultate

Ons het data van die Nasionale Gesondheid- en Voeding-ondersoekopname 2003–2006 en sterfterekords beskikbaar deur 2011 (opvolgperiode van ≈6,6 jaar 700 sterftes) ontleed om die assosiasies tussen objektief gemete fisiese aktiwiteit opgehoopte met en sonder 'n aanvalskriteria en alles te ondersoek -veroorsaak mortaliteit in 'n verteenwoordigende steekproef van Amerikaanse volwassenes 40 jaar en ouer (n=4840). Fisiese aktiwiteitsdata is verwerk om minute per dag van totale en oortollige MVPA te genereer. Bouted MVPA is gedefinieer as MVPA wat opgehoop is in aanvalle van 'n minimum duur van óf 5 óf 10 minute wat 1- tot 2-minuut onderbrekings toelaat. Gevaarverhoudings vir mortaliteit van alle oorsake wat geassosieer word met totale en aangetaste MVPA was soortgelyk en het gewissel van 0.24 vir die derde kwartiel van totaal tot 0.44 vir die tweede kwartiel van 10-minute aanvalle. Die ondersoek van gesamentlike geklassifiseerde kwartiele van totale MVPA en tertiele van proporsie van aangetaste aktiwiteit het aan die lig gebring dat groter hoeveelhede gebroke MVPA nie bykomende risikoverminderings vir mortaliteit tot gevolg gehad het nie.

Gevolgtrekkings

Hierdie resultate verskaf bewyse dat sterfterisikoverminderings wat met MVPA geassosieer word, onafhanklik is van hoe aktiwiteit opgehoop word en die ontwikkeling van fisieke aktiwiteitriglyne kan beïnvloed en kliniese praktyk kan inlig.

Kliniese Perspektief

Wat is nuut?

Hierdie studie ondersoek of matige-tot-kragtige fisiese aktiwiteit in periodes opgehoop moet word om sterftevoordele te bied.

Versnellingsmeter-gemete fisieke aktiwiteitsdata wat in 2003–2006 van 'n verteenwoordigende steekproef van Amerikaanse volwassenes (n=4840) ingesamel is, is geklassifiseer as sporadies of tydens aanvalle opgehoop en gekoppel aan sterfterekords beskikbaar deur 2011.

Sporadiese en matige tot kragtige fisiese aktiwiteit is soortgelyk en sterk geassosieer met sterfterisiko.

Vermindering van sterfterisiko's wat verband hou met matige tot kragtige fisiese aktiwiteit is onafhanklik van hoe aktiwiteit opgehoop word.

Wat is die kliniese implikasies?

Hierdie bevinding kan toekomstige riglyne vir fisieke aktiwiteit inlig en kliniese praktyk rig wanneer individue adviseer word oor die voordele van fisieke aktiwiteit.

Die sleutelboodskap gebaseer op die resultate wat aangebied word, is dat totale fisieke aktiwiteit (dws van enige tydsduur) belangrike gesondheidsvoordele bied.

Praktisyns kan óf lang enkele óf veelvuldige korter aktiwiteitsperiodes bevorder deur volwassenes te adviseer hoe om te vorder na 150 min/wk van matige-tot-kragtige fisiese aktiwiteit.

Hierdie buigsaamheid kan veral waardevol wees vir individue wat van die minste aktiewe is en waarskynlik 'n groter risiko loop om chroniese toestande te ontwikkel.

Die 2008 Fisiese Aktiwiteitsriglyne vir Amerikaners beveel aan dat volwassenes ten minste 150 min/wk van matige of 75 min/wk van kragtige-intensiteit fisieke aktiwiteit ophoop vir aansienlike gesondheidsvoordele. 1 Die riglyne bepaal ook dat aktiwiteit in periodes van ten minste 10 minute uitgevoer word. Die 10-minute bout-kriterium het in 1995 ontstaan ​​en was bedoel om buigsaamheid te bied om die aanbevole dosis te bereik. 2 Hierdie boodskapverskuiwing het die belangrikheid van die opbou van 'n totale volume van matige-tot-kragtige fisiese aktiwiteit (MVPA) beklemtoon en het 'n sentrale kenmerk van riglyne gebly soos dit ontwikkel het. Verbasend genoeg is bewyse wat 'n minimum aanval van 10 minute ondersteun, beperk. 3 Onlangse studies wat MVPA opgehoopte in aanvalle vergelyk met totale minute, ongeag die aanvalle, dui daarop dat aanvalle geen bykomende voordeel bied met betrekking tot metaboliese sindroom, middellyf-omtrek en liggaamsmassa-indeks nie. 4, 5, 6, 7, 8 Hierdie studies is egter beperk tot deursnee-ontwerpe wat risikofaktore geëvalueer het, wat dit moeilik maak om die tydelike volgorde vir die waargenome assosiasies of die invloed van MVPA-aanvalle op eindpunte, soos alle - sterftes veroorsaak. Dus, of slegs aanvalle of totale opgehoopte MVPA meer voordelig is vir mortaliteit, bly onseker.

Metodes

Bestudeer Bevolking

Die data, analitiese metodes en studiemateriaal is beskikbaar vir ander navorsers vir doeleindes om die resultate te repliseer of die prosedure te herhaal. Data is beskikbaar by https://wwwn.cdc.gov/nchs/nhanes/Default.aspx en bykomende besonderhede oor die analitiese metodes kan op versoek verskaf word. Studiedata is van NHANES (Nasionale Gesondheid- en Voeding-eksamenopname) 2003–2006-siklusse. NHANES monsters nie-geïnstitusionaliseerde Amerikaanse burgerlikes met behulp van 'n veelfase-waarskynlikheidsteekproefontwerp wat geografiese gebied en minderheidsverteenwoordiging in ag neem. Steekproefgewigte word gegenereer om nasionaal verteenwoordigende ramings te skep vir die Amerikaanse bevolking en subgroepe gedefinieer deur ouderdom, geslag en ras/etnisiteit. Sien https://www.cdc.gov/nchs/nhanes/about_nhanes.htm vir meer besonderhede oor NHANES-steekproefprosedures. NHANES versamel data oor verskeie gesondheids- en gedragsaanwysers, insluitend fisieke aktiwiteit en selfgerapporteerde diagnose van algemene gesondheidstoestande soos diabetes mellitus, koronêre arteriesiekte, beroerte en kanker. Hierdie data is saamgevoeg met sterfterekords van die Nasionale Sterfteindeks, beskikbaar deur Desember 2011. Die Nasionale Sentrum vir Gesondheidstatistiek koppel sterfterekords beskikbaar deur die Nasionale Sterfteindeks met individue in die onderskeie NHANES-databasis deur verskeie individuele inligting soos sosiale sekerheidsnommer, voornaam, geboortemaand, geslag, ras en ander. 9 Die passingsproses/koppeling verskaf lewensbelangrike status vir elke individu wat getoon is om 87% tot 97% van die ware sterfterekords akkuraat te identifiseer en is redelik akkuraat oor ras/etnisiteit heen. 10 , 11 , 12 Ons studie het gekoppelde mortaliteit NHANES-data gebruik wat deur die Nasionale Sentrum vir Gesondheidstatistiek aan die publiek vrygestel is en die analitiese steekproef beperk tot volwassenes van 40 jaar en ouer met volledige data oor alle veranderlikes van belang (N=4840 respondente). Besonderhede van hierdie kohort is elders gerapporteer. 13 Die NHANES-studie is hersien en goedgekeur deur die Nasionale Sentrum vir Gesondheidstatistiek Navorsingsetiekoorsigraad en alle deelnemers het ondertekende toestemming vir deelname verskaf.

Assessering van Fisiese Aktiwiteit

Fisiese aktiwiteit is gemeet met 'n middellyf-gedra eenassige versnellingsmeter (AM-7164 ActiGraph) vir tot 7 dae met behulp van 'n gestandaardiseerde protokol. 14 Data is aanvanklik gekeur vir nie-dra tyd met behulp van 'n voorheen ontwikkelde algoritme vir NHANES versnellingsmeter data. 14 Dae met minder as 10 uur se dratyd is uitgesluit en deelnemers met ten minste 1 geldige dag van versnellingsmeterdata is by die analise ingesluit. 'n Drempel van 760 tellings per minuut het MVPA gedefinieer. Hierdie drempel is gedefinieer om 'n breër reeks lewenstyl- en ambulante aktiwiteite vas te lê en is gedemonstreer om akkurate skattings te verskaf van tyd wat in MVPA spandeer word. 15, 16, 17 Minute van aktiwiteit is bereken vir 3 mate van MVPA: totaal sonder aanvalsbeperking, opgehoop in ≥5-minuut-aanvalle en opgehoop in ≥10-minuut-aanvalle. MVPA opgehoop in periodes van 5 of 10 minute, toegelaat vir onderskeidelik 1 en 2 minute van aktiwiteittellings <760 tellings per minuut om werklike aktiwiteitspatrone te akkommodeer (bv. stop by 'n kruispad terwyl jy stap).

Statistiese analise

Alle ontledings is uitgevoer met Cox proporsionele gevaarmodelle deur gebruik te maak van gevestigde kovariate van die fisiese aktiwiteit-sterfte-assosiasie 13: ouderdom (jare), geslag, ras-etnisiteit (nie-Spaans wit, nie-Spaans swart, Spaans, ander), onderwys (minder as hoërskool, hoërskool diploma, hoërskool of meer), alkoholverbruik (nooit, voormalige, huidige), rookstatus (nooit, voormalige, huidige), liggaamsmassa-indeks (<25, 25–29,9, ≥30 kg/m 2 ), en self-gerapporteerde diagnose (ja/nee) van diabetes mellitus, koronêre arteriesiekte, beroerte, kanker en mobiliteitsbeperking.

Eerstens het ons mortaliteitsassosiasies volgens kwartiele vir elk van die 3 MVPA-maatreëls ondersoek: totale, ≥5-minuut en ≥10-minuut-aanvalle, sonder om verskille in aktiwiteitsvolume in ag te neem. Totale MVPA was soortgelyk oor die 3 maatreëls en het sterk gekorreleer (r=0.7-0.9) (Tabel S1), wat daarop dui dat die maatreëls nie onafhanklik was nie en dat individue wat die meeste totale MVPA opgehoop het, ook hoë hoeveelhede MVPA in 5- of 10-minute-aanvalle opgehoop het.

Om rekening te hou met die afhanklikheid tussen totale en aangeplante aktiwiteit, het ons gesamentlik kwartiele van totale MVPA geklassifiseer volgens aangevulde aktiwiteit, gebaseer op tertiele van die proporsie van totale MVPA wat in periodes van ≥5 of ≥10 minute opgehoop is. Dit het gelei tot 12 kategorieë van totale MVPA en relatiewe bydrae van gewraakte MVPA. Baie deelnemers, veral in die onderste kwartiele van totale MVPA, het 0 aanvalle van ≥10 minute gehad. Dit het gelei tot onstabiele skattings, so ontledings het gefokus op periodes van ≥5 minute. In hierdie ontledings, sal bewyse van groter voordeel vir aangetaste aktiwiteit gedemonstreer word deur laer gevaarverhoudings (HR's) namate die bydrae van aanvalle tot totale MVPA toegeneem het. Om die verband tussen hierdie blootstellings verder te beskryf, het ons die risikoskattings vir elk van die 12 kategorieë teenoor totale MVPA geplot. Die aanname van proporsionele gevare is getoets en geld vir ons MVPA-blootstelling. Alle ontledings was verantwoordelik vir die komplekse opname-ontwerp in NHANES en is uitgevoer met behulp van die SAS weergawe 9.3 (SAS Insistute Inc) en SUDAAN (RTI International) statistiese pakkette.

Resultate

Oor 'n gemiddelde opvolg van 6,6 jaar is 700 sterftes aangeteken. Deelnemers was 46,7% manlik en 77,4% nie-Spaans blankes, 17,4% het minder as hoërskoolopleiding gehad, 21,1% was huidige rokers, en 62,0% het gerapporteer dat hulle alkohol gedrink het.

Vir elk van die 3 MVPA-maatreëls was groter MVPA geassosieer met laer mortaliteit (P tendens <0.01 Figuur 1). HR'e het gewissel van 0.24 tot 0.44 en was byna identies vir elke maatstaf. Byvoorbeeld, risiko was soortgelyk in die boonste kwartiele vir totale MVPA (HR, 0.27 95% vertrouensinterval [CI], 0.16–0.45), 5-minute aanvalle (HR, 0.28 95% CI, 0.17–0.45) en 10‐ minuut aanvalle (HR, 0,35 95% CI, 0,23–0,53) (Tabel S2).Onder die kategorieë wat gesamentlik geklassifiseer is deur kwartiele van totale MVPA en tertiele van gebulderde MVPA, was groter totale MVPA geassosieer met laer mortaliteit, maar groter proporsies van aangetaste MVPA het geen bykomende risikovermindering getoon nie (Tabel). Spesifiek, binne 'n gegewe kwartiel van MVPA, was HR's soortgelyk oor tertiele van bou-proporsie (Tabel, kolomme 2-4). Byvoorbeeld, in die eerste MVPA-kwartiel, het hoër bydraes van gebroke aktiwiteit gelei tot soortgelyke HR'e vir matige (0.75 95% CI, 0.60-0.95) en hoë hoeveelhede geboude aktiwiteit (0.77 95% CI, 0.60-0.99). HR'e oor tertiele binne elk van die oorblywende kwartiele was ook soortgelyk. Ontledings wat met periodes van ≥10 minute herhaal is, was onstabiel in die laagste 2 kwartiele omdat >30% van die steekproef geen ≥10-minute periodes gehad het nie, maar dieselfde patroon vir kwartiele 3 en 4 getoon het (data nie gewys nie). Om hierdie verhoudings te visualiseer, het ons die HR's vir elk van die 12 kategorieë geplot volgens totale MVPA in elke kategorie (Figuur 2). In die algemeen was groter totale MVPA geassosieer met laer mortaliteit, wat 'n plato bereik het teen ongeveer 100 min/d, met geen noemenswaardige bykomende voordeel van groter relatiewe bydraes van aangetaste aktiwiteit nie. Dit was ook duidelik dat die akkumulering van groter totale MVPA deurlopende periodes van aktiwiteit vereis het.

Figuur 1. Belangrikste effekte vir kwartielspesifieke verdelings van totale minute per dag van matige-tot-kragtige fisiese aktiwiteit (MVPA), en beide ≥5- en ≥10-minute periodes van opgehoopte minute per dag van MVPA. Kwartiele: totale MVPA (≤40.2, 40.2–79.5, 79.5–123.4, en >123.4 min/d) 5-minuut-wedstryde MVPA (≤10.7, 10.7–34.3, 34.3–70.7 en >7) 1. ‐minuut bouts MVPA (0.0, 0.0–5.1, 5.1–20.5, >20.5 min/d). Gevaarverhoudings word aangepas vir ouderdom, geslag, ras-etnisiteit, opvoeding, alkoholverbruik, rookstatus, liggaamsmassa-indeks, en self-gerapporteerde diagnose van diabetes mellitus, koronêre arteriesiekte, beroerte, kanker en mobiliteitsbeperking.

Tabel 1. Mortaliteit HR'e vir gesamentlike effekte van totale MVPA en proporsies van geboude (≥5 minute) MVPA

CI dui op vertrouensinterval.

a Bereken as (minute per dag van matige-tot-kragtige fisiese aktiwiteit [MVPA] in ≥5-minute aanvalle per totale minute per dag van MVPA)×100. Som van sporadiese en gebroke MVPA kan totale MVPA oorskry as gevolg van toelating vir minute onder die drempel in wedstryde. Gevaarverhoudings (HR's) word aangepas vir ouderdom, geslag, ras-etnisiteit, opvoeding, alkoholverbruik, rookstatus, liggaamsmassa-indeks en self-gerapporteerde diagnose van diabetes mellitus, koronêre arteriesiekte, beroerte, kanker en mobiliteitsbeperking.

Figuur 2. Verspreiding van gevaarverhoudings wat in die Tabel verskaf word volgens die totale duur van matige-tot-kragtige fisiese aktiwiteit (MVPA) vir gesamentlik geklassifiseerde kwartiele van totale minute en tertiele van relatiewe bydrae van gestrekte minute. Byvoorbeeld, 4,1 is gelykstaande aan gekombineerde kwartiel 4 van totale MVPA en tertiel 1 (Tabel) van die relatiewe bydrae van gebou tot totale minute. Die relatiewe bydrae (%) van aangetaste MVPA-minute het gewissel van 3% (heldergeel) tot 81% (donkerrooi). Die gesamentlike groep 4,1 verteenwoordig 150 minute in totale MVPA en ≈50% van die totale duur is opgehoop in aanvalle van ≥5 minute. Die oorblywende 50% is opgehoop in sporadiese aktiwiteit. Die grys foutstawe dui die boonste en onderste 95% vertrouensintervalle vir onderskeie gevaarverhoudings aan. Gevaarverhoudings word aangepas vir ouderdom, geslag, ras-etnisiteit, opvoeding, alkoholverbruik, rookstatus, liggaamsmassa-indeks, en self-gerapporteerde diagnose van diabetes mellitus, koronêre arteriesiekte, beroerte, kanker en mobiliteitsbeperking.

Bespreking

Hierdie voornemende studie het die relatiewe voordele van gebroke versus sporadiese MVPA op mortaliteit in 'n verteenwoordigende steekproef van Amerikaanse volwassenes ondersoek, met behulp van 'n objektiewe maatstaf van fisiese aktiwiteit. Groter totale MVPA was sterk geassosieer met laer mortaliteit, en aangetaste aktiwiteit het min bykomende voordeel ingehou. Hierdie resultate verskaf dus bewyse dat sterfterisikoverminderings wat met MVPA geassosieer word, onafhanklik is van hoe aktiwiteit opgehoop word. Hierdie resultate kan die ontwikkeling van die tweede uitgawe van die Fisiese Aktiwiteitsriglyne vir Amerikaners en ander aanbevelings inlig.

Verskeie gepubliseerde studies het die assosiasies tussen fisieke aktiwiteit en mortaliteit ondersoek en is gebruik om die huidige riglyne vir fisieke aktiwiteit in te lig. 3 Die meeste van hierdie studies het egter staatgemaak op data verkry uit selfverslae en slegs 'n paar het hierdie assosiasies ondersoek deur toestelgebaseerde maatstawwe van fisiese aktiwiteit te gebruik. 13, 18, 19, 20, 21, 22, 23 Alhoewel die huidige riglyne vir fisieke aktiwiteit aanbeveel dat aktiwiteit in periodes van ≥10 minute opgehoop word, het die meeste van hierdie studies ook die relatiewe voordele van sporadiese MVPA ondersoek. Die paar studies wat spesifiek die waarde van aangetaste fisieke aktiwiteit ondersoek het, het getoon dat sporadiese versus aangetaste aktiwiteit soortgelyke assosiasies gehad het met die metaboliese sindroom, middellyf-omtrek en liggaamsmassa-indeks. 4, 5, 6, 7, 8 Al hierdie studies het egter deursnee-ontwerpe gebruik en intermediêre eindpunte ondersoek. Hierdie studies kon dus nie die bykomende vraag aanspreek of sporadiese en aangetaste aktiwiteit soortgelyke gesondheidsvoordele kan bied nie. In ons studie, soortgelyk aan vroeër gepubliseerde NHANES-studies, het ons gevind dat risikoverminderings vir mortaliteit van alle oorsake wissel van 60% tot 80% oor verhoogde hoeveelhede opgehoopte sporadiese MVPA. Die sleutelbevinding van ons studie was egter dat verlaagde risiko vir alle oorsake mortaliteit geassosieer met sporadiese MVPA nie anders was as die verlaagde risiko wat verband hou met aktiwiteit wat in periodes van ≥5 minute opgehoop is nie. Hierdie bevinding stem ooreen met vorige studies wat deursnee-assosiasies van sporadiese versus aangetaste aktiwiteit met verskeie gesondheidsrisikofaktore ondersoek, maar dit verskaf nuwe bewyse dat voordele vir mortaliteit, 'n robuuste gesondheidseindpunt, onafhanklik is van hoe aktiwiteit opgehoop word.

Ons studie is die eerste wat data van 'n verteenwoordigende steekproef Amerikaanse volwassenes met toestelgebaseerde skattings van fisieke aktiwiteit gebruik om die voordele van sporadiese aktiwiteit te vergelyk. Ons ontledings bied 'n robuuste skatting van sulke voordele, maar sluit 'n paar uitdagings in wat die moeite werd is om te noem. Ons het gevind dat totale en aangeplante aktiwiteit hoogs gekorreleer is (r=0.7–0.9) en dat min individue in die Verenigde State aktiwiteit ophoop in periodes van ≥10 minute (>30% van die steekproef het geen 10-minuut aanvalle opgespoor nie). Hierdie voorlopige bevindinge het ons pogings gevorm om die assosiasies tussen sporadiese versus aangetaste aktiwiteit en mortaliteit te modelleer. Om hierdie uitdagings aan te spreek, het ons gesamentlik kwartiele van die totale MVPA geklassifiseer by verskeie bydraes van aangespanne aktiwiteit van ≥5 minute. Ons was nie in staat om die effekte van MVPA wat in periodes van ≥10 minute opgehoop is volledig te ontleed nie, maar waar data beskikbaar was, was resultate vir 5- en 10-minute aanvalle soortgelyk. Ons erken ook dat 'n verskeidenheid gepubliseerde snypunte beskikbaar is om MVPA-intensiteit te definieer. 18 NHANES-studies het algemeen gebruik gemaak van 2020-tellings per minuut, wat gebaseer is op ambulante kalibrasie, om MVPA te definieer, maar ons het gekies om 'n snypunt te gebruik wat gekalibreer is om 'n groter verskeidenheid lewenstylaktiwiteite vas te vang bykomend tot ambulante beweging. Ons geselekteerde snypunt is omvattend geëvalueer en gedemonstreer om waardevolle insigte te verskaf wanneer die assosiasies tussen fisieke aktiwiteit en mortaliteit ondersoek word. 13 , 15 , 16 , 17 , 23 Ons het die gebruik van die ambulante MVPA-drempel (dws 2020 tellings per minuut) in ons studie ondersoek, maar het beperkte bruikbaarheid gevind aangesien die meerderheid van ons steekproef geen MVPA opgehoop het in periodes van 10 minute met hierdie drempel. Ons het voorheen die assosiasies van sporadiese aktiwiteit ondersoek deur óf 760 óf 2020 tellings per minuut te gebruik en soortgelyke assosiasies met mortaliteit gevind (ongepubliseerde bevindings). Ons verwag dus nie dat ons gevolgtrekkings afhanklik sal wees van ons keuse van die 760-afsnypunt nie, en is van mening dat die omvang van ons assosiasies vir beide sporadiese en aangetaste aktiwiteit konserwatief kan wees.

Gevolgtrekkings

Ten spyte van die historiese idee dat fisieke aktiwiteit vir 'n minimum tydsduur uitgevoer moet word om betekenisvolle gesondheidsvoordele te bewerkstellig, verskaf ons nuwe bewyse dat sporadiese en aangetaste MVPA insgelyks geassosieer word met aansienlik verminderde mortaliteit. Hierdie bevinding kan toekomstige riglyne vir fisieke aktiwiteit inlig en kliniese praktyk rig wanneer individue adviseer word oor die voordele van fisieke aktiwiteit. Praktisyns kan óf lang enkele óf veelvuldige korter episodes van aktiwiteit bevorder deur volwassenes te adviseer oor hoe om na 150 min/wk van MVPA te vorder. Hierdie buigsaamheid kan veral waardevol wees vir individue wat van die minste aktiewe is en waarskynlik 'n groter risiko loop om chroniese toestande te ontwikkel.


Kyk die video: 43a: Classifying amines (Oktober 2022).