Inligting

Wat kan die heliese wielprojeksies in strukturele biologie gebruik?

Wat kan die heliese wielprojeksies in strukturele biologie gebruik?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Ek het heliese wielprojeksies gesien wat gebruik word om amfipatiese helikse in proteïene te illustreer. Is daar enige ander gebruike vir hierdie modelle?


Heljiese wielprojeksies kan handig wees wanneer u 'n proteïen of peptied met een of meer α-heliese streke het. Dit laat u toe om te sien of daar 'eienskappe' aan die een kant van 'n peptied is. Dit kan nuttig wees om potensiële proteïen-proteïen-interaksiemotiewe soos leucine-ritssluiters te herken.

Die Wikipedia -artikel oor "Heliese wiele" lyk ook na 'n goeie plek om meer hieroor te leer.


Die C-terminale domein van apolipoproteïen A-I bevat 'n lipiedgevoelige konformasionele sneller

Uitruilbare apolipoproteïene kan omskakel tussen lipiedvrye en lipied-geassosieerde toestande. Die C-terminale domein van menslike apolipoproteïen A-I (apoA-I) speel 'n rol in beide lipiedbinding en selfassosiasie. Terreingerigte spin-label elektron-paramagnetiese resonansespektroskopie is gebruik om die struktuur van die apoA-I C-terminus in lipiedvrye en lipiedverwante toestande te ondersoek. Nitroksied-spin-etikette wat op gedefinieerde plekke regdeur die C-terminus geplaas is, is gebruik om diskrete sekondêre strukturele elemente te definieer. Magnetiese interaksies tussen probes gelokaliseer op posisies 163, 217 en 226 in enkel en dubbel gemerkte apoA-I het inter- en intramolekulêre afstand inligting verskaf, wat 'n basis verskaf het vir die kartering van apoA-I tersiêre en kwaternêre struktuur. Spektra van apoA-I in gerekonstitueerde HDL het 'n lipied-geïnduseerde oorgang van gedefinieerde ewekansige spoele en β-stringe na α-helikse geopenbaar. Hierdie konformasie -skakelaar is analoog aan geaktiveerde gebeurtenisse in virale samesmeltingsproteïene en kan dien as 'n manier om die energiehindernisse van lipiedsekwestrasie te oorkom, 'n kritieke stap in cholesteroluitvloei en HDL -samestelling.


Membraanproteïene: die 'Wilde Weste' van strukturele biologie

Histories is die taak om die struktuur van membraanproteïene te bepaal, belemmer deur eksperimentele probleme wat verband hou met hul lipied-ingebedde domeine. Hier bied ons 'n oorsig van onlangs ontwikkelde eksperimentele en voorspellingshulpmiddels wat ons siening van hierdie grootliks onontginde gebied verander - die 'Wilde Weste' van strukturele biologie. Kristallografie, enkeldeeltjie-metodes en atoomkragmikroskopie word gebruik om groot membraanproteïene met toenemende detail te bestudeer. Vastetoestand kernmagnetiese resonansiestrategieë verskaf oriëntasiebeperkings vir struktuurbepaling van transmembraan (TM) α-helikse en akkurate metings van intramolekulêre afstande, selfs in baie komplekse stelsels. Langer afstandbeperkings word bepaal deur plekgerigte spin-etiketterings elektron paramagnetiese resonansie, maar huidige etiketteringstrategieë vorm steeds 'n mate van beperking. Ander metodes, soos plekspesifieke infrarooi dichroïsme, maak oriëntasieanalise van TM α-helikse in belynde dubbellaags moontlik en word, gekombineer met nuwe berekenings- en voorspellingsinstrumente wat evolusionêre bewaringsdata gebruik, gebruik om TM α-helikale bundels te ontleed.


Struktuur van die KcsA -kanaal intrasellulêre hek in die oop toestand

Ionkanale kataliseer die selektiewe oordrag van ione oor die membraan in reaksie op 'n verskeidenheid stimuli. Hierdie kanale maak toegang deur die toegang van ione tot 'n sentraal geleë met water gevulde porieë. Die kristalstruktuur van die Streptomyces lividans kaliumkanaal (KcsA) het 'n molekulêre verkenning van hierdie meganisme moontlik gemaak. Elektron paramagnetiese resonansie (EPR) studies het beduidende konformasie veranderinge aan die intrasellulêre einde van die tweede transmembraan heliks (TM2) by poorting ontbloot. Ons het terreingerigte spinetikettering (SDSL) en EPR-spektroskopie gebruik in 'n poging om die strukturele herrangskikkings van die KcsA TM2-bundel onder die oorgang van die geslote na die oop toestand te kwantifiseer. Onder toestande wat die geslote en oop konformasies bevoordeel, is 10 intersubunit -afstande verkry oor TM2 -segmente van tandem dimeer konstrukte. Ontleding van hierdie data dui op 'n meganisme waarin elke TM2-heliks weg van die deurdringingsbaan kantel, na die membraanvlak, en roteer om sy heliese as, wat 'n skêr-tipe beweging ondersteun met 'n spilpunt naby residue 107-108. Hierdie bewegings gaan gepaard met 'n groot toename in die deursnee van die voorportaal onder die sentrale watergevulde holte.


Resultate

Die S2-segment in Shaker strek oor residue 278–300 (Fig. 1 B). In integrale membraanproteïene met 'n bekende struktuur, is lipied blootgestelde residue in transmembraan helices geneig om meer hidrofobies en minder goed bewaar te wees as residue wat na die binnekant van die proteïen kyk (Rees et al., 1989 Taylor et al., 1994 Wallin et al., 1997). Vergelyking van S2-reekse in K + kanale beklemtoon die veranderlike residue (Fig. 1 B), wat wanneer gekarteer op 'n heliese projeksie lê hoofsaaklik op een vlak (Fig. 1 C). Die huidige eksperimente poog om hierdie volgorde-gebaseerde voorstel vir 'n α-helikale beskikking van S2 te toets. Ons gaan uit van die idee dat 'n lywige, hidrofobiese tryptofaan-substitusie die kanaalstruktuur (en dus die ablaatfunksie) meer geneig is om die struktuur van die kanaal te versteur as dit op posisies gepak word teen ander dele van die proteïen as wanneer dit op lipiede blootgestel word. Ons het dus elke S2 ​​-residu individueel gemuteer tot tryptofaan (of die enkele tryptofaan tot alanien), in die vooruitsig dat posisies wat funksioneel vergewe van mutasie, afgewissel sou word, moontlik in spiraalvormige periodisiteit, met posisies gekenmerk deur die versuim om K + -stroom uit te druk. Alhoewel dit nie streng geregverdig is nie, is hierdie verwagting aanneemlik, aangesien sulke substitusietoleransiepatrone waargeneem is met verskeie membraanproteïene, oorspronklik met willekeurig geselekteerde residue (Hinkle et al., 1990), en meer onlangs met spesifiek ingevoegde tryptofane (Choe et al., 1995 Sharp et al., 1995 Collins et al., 1997).

Ons resultate weerspreek hierdie verwagting. Van die 23 vervangings wat gemaak is, kon slegs een (R297W) nie die huidige in uitdruk nie Xenopus oösiete. Verteenwoordigende strome in reaksie op depolariserende spanningspulse word in Fig. 2 getoon vir die wildtipe kanaal en twee mutante. Hierdie spesifieke mutante kanale toon veranderde spanningsafhanklikhede, die aktiveringskromme vir I287W is 27 mV na regs, terwyl die vir E293W 22 mV na links skuif. Hierdie twee mutante word op ander maniere verander, die helling van die aktiveringskromme word verminder in I287W, en beide die aktiverings- en deaktiveringskinetiek van E293W word aansienlik vertraag. Soortgelyke opnames is vir die oorblywende Trp-gesubstitueerde kanale ingesamel. Die effekte van die substitusies is ontleed met behulp van verskeie empiriese parameters: ΔGo (die nulspanningsvrye energie van opening), to (die aktiveringshalftyd gemeet aan die halfpunt op die aktiveringskromme), en τd (die deaktiveringstydkonstante by -70 mV). Hierdie parameters word in Tabel I vir alle mutante kanale getoon. Fig. 3 A teken die oop-toestand stabiliseringsenergie ΔΔGo dit wil sê die verskil in ΔGo tussen mutante en wilde tipe. Altesaam 13 mutante kanale het elektrofisiologiese eienskappe soortgelyk aan wilde tipe, ons definieer hierdie residue as "lae impak" of "verdraagsaam," met |ΔΔGo| & lt 1 kcal/mol. Die oorblywende 9 "hoë-impak" posisies (E283, T284, C286, I287, W289, F290, E293, L294 en A300) het eienskappe wat aansienlik verskil van wilde tipe. Hierdie binêre snit tussen die twee tipes residue is natuurlik arbitrêr, maar dit val natuurlik uit die resultate, ons algehele gevolgtrekkings verander nie as ons hierdie afsnywaarde verdubbel of halveer nie. In die meeste kanale met veranderde ewewigsaktiveringseienskappe is die kinetiese parameters ook groter as tweeledig verander (Fig. 3, B en C). Ons beklemtoon dat die bedoeling van hierdie hekanalise empiries is, nie meganisties nie: om posisies te identifiseer waar mutasies ooglopende en growwe veranderinge in hekwerk veroorsaak, nie om die stappe in die aktiveringspad wat deur die mutasies verander word, te verstaan ​​nie.

Die meeste van die verdraagsame posisies dra groot, hidrofobiese residue (Fig. 1), en dus veroorsaak hul mutasie na Trp slegs matige veranderinge in sykettingvolume. Ons het dus hierdie posisies uitgedaag met meer radikale veranderinge van sykettingchemie. Ons het 'n stel Asn-substitusies saamgestel wat die volume van die syketting en die polariteit van Trp-tolerante posisies sou verander: L285N, I288N, F292N, V296N, F298N en L299N. Opvallend is dat al ses mutante kanale uitgedruk het wat elektrofisiologiese eienskappe vertoon, soortgelyk aan dié van die wilde tipe kanaal (Fig. 4 en Tabel II).


MATERIAAL EN METODES

P. tetraurelia voorbereiding van kortikale eenheid

Twee P. tetraurelia stamme is gebruik: die d4-2 wilde tipe verwysingstam en Δ-CenBP1. Selle is eksponensieel gegroei by 27°C in 'n koringgrasinfusie (BHB-medium), gebakteriseer met Klebsiella pneumoniae, en aangevul met β-sitosterol (0,4 ug/ml). Selle is 2 minute by 137 gesentrifugeerg met behulp van 'n Sigma 6-15 sentrifuge en twee keer in Dryl buffer gewas om die meeste bakterieë te verwyder. Trychosiste is deur tris CaCl verwyder2 buffer [10 mM (pH 7,4) en CaCl2 1 mM] aangevul met 0.025% amino-etieldekstraan. Selle is herwin deur sentrifugering, en P. tetraurelia korteks is voorberei volgens (24) met die volgende wysigings: Selle is gesuspendeer in 'n gelyke volume lysisbuffer wat 0,25 M sukrose, 1 mM Hepes (pH 7,2), 5 mM EGTA en 2 × protease-remmers (Roche cOmplete) bevat en oorgedra na 'n Potter-Elvehiem homogeniseerder en laat dan 15 minute op ys. Ongeveer 400 handstrepe was nodig om oop te maak en gt95% van die selle oop te breek. Na lise is 1 M K-PYPE (pH 7.2) bygevoeg om 'n finale konsentrasie van 10 mM K-PYPE te verkry. Sel korteks is twee keer gewas in resuspensie buffer met lysis buffer met 10 mM K-PIPES en herwin deur sentrifugering by 410g in 'n verkoelde Eppendorf -sentrifuge. Die sel korteks is in 500 ul van dieselfde buffer gesuspendeer. Om kortikale eenhede te verkry, is die korteks vir 5 s op ys gesoniceer met 1 s effektiewe pols en 1 s pouse by 30% van amplitude met behulp van 'n Vibra-sel verwerker. Kortikale eenhede is gestoor in 10 mM K-Pype 60% sukrose (w/w) by -80°C.

Die kwaliteit van die korteks en kortikale eenhede is geverifieer deur immunofluoressensie na sedimentasie by 10 000g 15 minute lank in 'n swaaiende rotor (Beckman JS-13.1) op glasdeksels in Corex-buise van 15 ml, toegerus met adapters soos voorheen beskryf (25). Kortikale eenhede is met 'n anti-epiplasmin gekleur, en sentriole is met ID5 teenliggaam gekleur. Aangesien beide teenliggaampies in muise geproduseer is en albei verskillende strukture herken, is die teenliggaampies opeenvolgend bygevoeg.

P. tetraurelia sentriole cryo-ET

P. tetraurelia sentriole is 1: 5 verdun in 10 mM K-PIPES aangevul met 10 nm kolloïdale goue krale (Aurion). Sentriole is op 300-gaas kantige koolstofroosters (elektronmikroskopiewetenskappe) neergesit, van die agterkant afgevee en in vloeibare etaan verglaas deur handmatig te vries. Roosters is oorgedra na 'n 300 kV FEI Titan Krios transmissie-elektronmikroskoop (Sentrum vir Sellulêre Beeldvorming en NanoAnalytics, Biozentrum, Universiteit van Basel) toegerus met 'n Gatan K2 Summit direkte elektron detektor. Enkele-as kantelreekse is verkry met behulp van SerialEM (26), met 2° inkremente van ongeveer -60° tot +60° (tweerigting, geskei teen 0°). Vergroting was ×29 000 met 'n voorwerppikselgrootte van 3,45 Å en 'n kumulatiewe dosis van 70 tot 120 elektrone/Å 2 .

C. reinhardtii selkultuur

In situ cryo-ET van C. reinhardtii sentriole is uitgevoer in die mat3-4 stam (CC-3994) (27) verkry van die Chlamydomonas Resource Center, University Minnesota, MN. Hierdie ras het kleiner selle (

5 μm in deursnee), wat vergrootglas verbeter en die waarskynlikheid verhoog dat 'n sentriole getref word deur gefokusde ioonbalk (FIB) maal. Selle is in tris-asetaat-fosfaat medium gekweek, met normale atmosfeer geborrel en aan konstante lig blootgestel (

C. reinhardtii selvitrifikasie en cryo-FIB maal

Toe selkulture midde-logfase bereik het, is hulle vergiftig met 'n Vitrobot Mark 4 (FEI Thermo Fisher Scientific). Die selkultuur (4 ul van

1000 selle/ul) is van die agterkant af op 'n 200-maas koper EM-roosters bedek wat met gatige koolstof bedek is (R2/1, Quantifoil Micro Tools) en in 'n vloeibare etaan/propaanmengsel gedompel. Cryo-FIB monstervoorbereiding is uitgevoer soos voorheen beskryf (13) met behulp van óf 'n FEI Scios óf FEI Quanta dual-beam FIB/scanning EM-instrument. EM-roosters is in AutoGrid-ondersteuningsringe (FEI Thermo Fisher Scientific) gemonteer, in die FIB gelaai met 'n cryo-shuttle, en dan bedek met 'n organometaal platinumlaag deur gebruik te maak van 'n gasinspuitingstelsel (FEI Thermo Fisher Scientific). Selle is in verskeie stappe verdun met 'n gallium -ioonbundel om te produseer

100 tot 200 nm dik sellulêre afdelings (lamelle).

C. reinhardtii cryo-ET

EM-roosters is oorgeplaas in 'n 300 kV FEI Titan Krios transmissie-elektronmikroskoop (Departement Molekulêre Strukturele Biologie, Max Planck Instituut vir Biochemie), toegerus met 'n na-kolom energiefilter (Quantum, Gatan) en 'n direkte detektorkamera (K2 Summit , Gatan). Gebruik SerialEM sagteware (26), kantelreekse is verkry met 2 ° trappe tussen -60 ° en + 60 ° (tweerigting, geskei by -0 ° of -20 °). Boonop is 'n dosis-simmetriese kantelskema geïmplementeer vir 'n deelversameling verworwe sentriole (28). Individuele kantels is opgeneem in filmmodus teen 12 rame/s, met 'n voorwerppikselgrootte van 3,42 Å en 'n defokus van −5 tot −6 μm. Die totale opgehoopte dosis vir elke kantelreeks het gewissel tussen 80 en 130 elektrone/Å 2, afhangende van die dikte van die monster. Verskeie verskillende kulture en beeldsessies is gebruik om die datastel te vervaardig. Elke in situ tomogram is verkry uit 'n aparte C. reinhardtii sel en is dus 'n biologiese sowel as tegniese herhaling.

N. gruberi selkultuur en differensiasie

N. gruberi selle (NEG-stam verskaf deur C. Fulton, Brandeis Universiteit) is gedifferensieer van amoebes in flagellate met behulp van 'n standaard protokol (29). Amoebes is op vaste media gekweek met Klebsiella bakterieë as voedselbron oornag by 30 ° C totdat plate was

80% vry van bakterieë. Yskoue differensieringsbuffer [2 mM tris (pH 7,2) en 10 mM NaCl] is by die plate gevoeg en selle is met 'n glasstrooier afgeskraap en in 50 ml plastiese koniese buise gegooi. Met behulp van 'n International Equipment Company CLINICAL (IEC model CL) sentrifuge wat met 'n handrem aangepas is, is amoë 1 min geskors en daarna twee keer vinnig met yskoue differensiasiebuffer gewas (weer gesuspendeer deur vortexing en vir 45 sekondes geskud) om die bakterieë te verwyder. Die amoebae is dan weer gesuspendeer in 25 ° C differensieringsbuffer, wat in 'n 1-liter Erlenmeyer-fles geplaas en by 100 Hz in 'n 25 ° C waterbad geskud is. Om sinchroniese differensiasie te verseker (wat bevestig is deur fase-kontrasmikroskopie van selle wat met Lugol se jodium gekleur is), is die tyd vanaf die skraap van die selle tot die skud daarvan in die waterbad onder 10 min gehou.

Isolasie en verglasing van N. gruberi sentriole

Sentriole is geïsoleer tussen 50 en 100 minute na die aanvang van differensiasie om sentriole in verskillende toestande van samestelling te verkry (30). Pare sentriole sit in tandem bymekaar, met die eerste sentriool wat samestelling 5 tot 10 min voor die tweede sentriool voltooi (31). Tussen 60 en 70 minute na die aanvang van differensiasie dok die sentriole by die plasmamembraan aan en begin ciliogenese. Vir hierdie studie van MTT's -argitektuur het ons slegs volwasse sentriole ontleed wat die MTD's van die ciliêre aksonem begin groei het.

Die sentriool isolasie protokol is aangepas uit verskeie vorige studies (14, 32, 33). Selle is weer gesuspendeer in lysisbuffer [15 mM tris (pH 7,5), 10 mM KCl, 2 mM MgSO4, 1,5 mM EGTA, 1 mM ditiothreitol, Roche cOmplete EDTA-vrye protease-remmer cocktail, en 0,1% Triton X-100] en gelys met 5 tot 10 beroertes in 'n Dounce-homogeniseerder (volledige sellysis is bevestig met 'n fase-kontrasmikroskoop voor gaan voort). Kerne en puin met groot sel is verwyder deur die lisaat op 'n 25% sukrose kussing teen 1000 te draaig vir 15 min. Die supernatant en koppelvlak is verdun in wasbuffer (lysisbuffer sonder skoonmaakmiddel) in 'n ronde bodem van Oak Ridge en in 'n Sorvall HB-4 swaaibakrotor met 'n korrel van 10 000g vir 30 min. Die korrel is hersuspendeer in 10 ml wasbuffer en gelaai bo-op 'n diskontinue 40%/50% sukrosegradiënt in 'n Oak Ridge buis, wat in die HB-4 rotor gesentrifugeer is teen 16 000g vir 90 min (geen rem). Gebruik verligting van die onderkant van die buis en 'n spuit met 'n lang naald,

5 ml is uit die 40%/50% -koppelvlak onttrek en in suspensiebuffer geresuspendeer en daarna weer in 'n Oak Ridge -buis gegorrel wat met 10 000 sentrifuge gespin is.g vir 30 min. Die korrel is in 'n klein volume gesuspendeer (

30 μl) wasbuffer aangevul met 10 nm kolloïdale goud [bees serum albumien (BSA) suspensie, Aurion]. Deur 'n Vitrobot Mark 4 (FEI Thermo Fisher Scientific) te gebruik, is 5 μl van hierdie monster op 200-maas koper EM-roosters bedek wat met hol koolstof (R3.5/1, Quantifoil Micro Tools) bedek is en in 'n vloeibare etaan gedompel gevries. propaan mengsel.

N. gruberi cryo-ET

EM roosters is oorgedra soos beskryf in die C. reinhardtii cryo-ET-afdeling. Kantelreeks is op dieselfde manier verkry. Individuele kantels is opgeneem in filmmodus teen 10 rame/s, met 'n voorwerppikselgrootte van 4,21 Å en 'n defokus van −5 tot −8 μm. Die kumulatiewe dosis vir elke kantelreeks was

80 tot 120 elektrone/Å 2 . Verskeie verskillende kulture en beeldsessies is gebruik om die datastel te vervaardig. Elke paar sentriole kom uit 'n aparte sel en kan dus as 'n biologiese herhaling beskou word.

Menslike sentriool isolasie

Menslike sentriole is geïsoleer van die limfoblastiese KE-37-sellyn soos voorheen beskryf (25) maar soos volg gewysig. Na sentrioolsedimentasie op 'n 60% sukrosekussing deur sentrifugering, is die boonste derde van die volume van die sentrifugeringbottel verwyder deur aspirasie, wat 20 tot 25% sukrose in 'n volume van ongeveer 25 ml gelaat het. Die 60% sukrosekussing wat geïsoleerde sentriole bevat, is dan hersuspendeer totdat die sukrose nie meer sigbaar was deur sagte pipettering nie. Die finale sukrose konsentrasie was 30%. Alikvote (500 ul) is vinnig gevries in vloeibare stikstof en gestoor by -80 ° C. Die sentriool isolasie doeltreffendheid is geverifieer deur immunofluoressensie.

Menslike sentriool cryo-ET

Soos voorheen beskryf (14), is 'n alikwotfraksie van 500 μl eers in 1 ml 10 mM K-PIPES (4 ° C, pH 7,2) geresuspendeer en daarna by 10,400 gesentrifugeerg vir 10 minute by 4 ° C.Die korrel wat die sentriole bevat, is in 20 ul 10 mM K-PIPES geresuspendeer en verder verdun met 10 ul 10-nm kolloïdale goue krale (Aurion). Vyf mikroliter van die monster is dan neergesit op 300-maas-kantkoolstofroosters (Electron Microscopy Sciences), van die agterkant afgevee, en verglaas in vloeibare etaan deur handvriesing. Roosters is oorgedra soos hierbo beskryf. Enkele-as kantelreekse is verkry met SerialEM in stappe van 2 ° met 'n tweerigtingskema van ongeveer −60 ° tot +60 °, geskei in helftes by −20 °. Individuele kantels is in die filmmodus met 10 rame/s opgeneem. Vergroting was × 42,000 met 'n voorwerppikselgrootte van 3,42 Å en 'n kumulatiewe dosis van

Subtomogram gemiddeld

Alle kantel-reeks rame is in lyn gebring met behulp van MotionCor2 (34) met behulp van 3 × 3 lappies of heelraambelyning. Vervolgens is alle tomogramme van alle spesies gerekonstrueer met behulp van etomo, deel van die IMOD-pakket (35). Die kontrasoordragfunksie (CTF) van tomogramme is reggestel met behulp van CTFplotter en CTFphaseflip -gereedskap van IMOD. Om subtomogramme van MTTs te genereer, is A- en C-mikrotubuli langs elke MTT gekies, wat nege stelle A-C-gepaarde koördinate langs die sentriool se sentrale streek genereer, altyd van proksimale kant tot distale kant. Op grond van die periodisiteit waargeneem in die Trichonympha proximale MTT's en op ons analise van periodieke sentrale gebiede (fig. S1), het ons besluit om elke 17 nm subtomogramme te onttrek om strukturele oortolligheid te beperk terwyl die volledige periodieke eenheid gehandhaaf word. Met behulp van 'n tuisgemaakte Python-skrif, is die posisies van die B-mikrotubules geïnterpoleer na aanleiding van die gebruiker-gedefinieerde MTT-periodieke en oriëntasies. Die posisionele inligting was nodig om die koördinate vir subtomogram-ekstraksie te ken (aangesien die B-mikrotubuli rofweg ooreenstem met die middelpunt van die MTT's), en die rotasies was nodig om alle subtomogramme vooraf in dieselfde oriëntasie te belyn (begin Euler-hoeke vir belyning). Hierdie rotasiewaardes word later as "voorbelyningsparameters" verwys. Subtomogramme is in 'n .tbl -formaat georganiseer en dan onttrek, in lyn gebring en gemiddeld met behulp van Dynamo (36). Die aantal subtomogramme, afmetings en aanvanklike verwysing was spesifiek vir elke spesie.

Vir die P. tetraurelia MTT's, 1693 subtomogramme van 288 × 288 × 288 voxels is uit 14 ongecomprimeerde sentriole onttrek. Vir die C. reinhardtii MTT's, 1546 subtomogramme van 296 × 296 × 296 voxels is uit 11 sentriole onttrek. Vir die N. gruberi MTTs, 1168 subtomogramme van 260 × 260 × 260 voxels is uit sewe sentriole onttrek. Hierdie drie datastelle is aanvanklik belyn met behulp van die ex vivo C. reinhardtii sentrale kern MTT's as 'n beginverwysing (emd-5252, 18). Na 'n paar herhalings is hulle in lyn gebring met hul onderskeie gemiddelde kaarte wat in elke rondte gegenereer is. Die iterasies is uitgevoer op ingeboude twee data, en die finale waardes vir verskuiwings en rotasies is toegepas op ongebinde subtomogramme.

Om die korrektheid van die struktuur te verseker, is 'n de novo -rekonstruksie uitgevoer P. tetraurelia en C. reinhadtii MTT's. Soos in fig. S7 (I tot R), beide benaderings (met behulp van 'n verwysing of de novo-gemiddelde) het dieselfde driedimensionele (3D) rekonstruksie tot gevolg gehad. Vir die de novo -gemiddelde is 'n ewekansige vertaling (tot 6 nm) by die Z posisie van elke deeltjie vanaf die aanvanklike belyning om te verseker dat die finale gemiddelde nie deur die aanvanklike pluk vooroordeel is nie. Deur hierdie vertaalde deeltjies te gebruik, is 'n eerste gemiddelde volume gegenereer sonder periodisiteit. Die datastel is dan in twee onafhanklike halfstelle verdeel. Vir die volgende stappe was die belyningsparameters dieselfde vir beide helftes. Deeltjies is op die eerste gemiddelde in lyn gebring totdat hul boaansigte goed in lyn was (drie iterasies vereis). Aangesien die syaansig swak opgelos is, is 'n masker op die binneste struktuur aangebring en deeltjies is in lyn gebring vir nog 'n ronde. Nadat gekontroleer is of die periodisiteit beter gerekonstrueer is, is 'n herhaling uitgevoer met 'n masker wat die hele drieling bedek. Let daarop dat vir die de novo -benadering deeltjies in lyn was met bin2 -afmetings vir P. tetraurelia en bin4 afmetings vir C. reinhardtii. Volgens die Fourier-dopkorrelasie (FSC) = 0,143 kriterium, die resolusie van die P. tetraurelia de novo rekonstruksie is 33 Å, en die resolusie van die C. reinhardtii de novo rekonstruksie is 47 Å. Let daarop dat ons fokus op die binneste steier is en dat ander kenmerke soos die periodisiteite van die mikrotubule binneste proteïen (MIP) deur die periodisiteit van die binneste steier opgelê kon word. Daarom lei ons niks tot die gevolgtrekking oor hierdie ander strukturele kenmerke nie.

Vir die menslike MTT's is 398 subtomogramme van 296 × 296 × 296 voxels uit 12 sentriole onttrek en in lyn gebring met behulp van die ex vivo Cricetulus griseus MTT se struktuur as 'n beginverwysing (emd-7777, 15). Die klein aantal subtomogramme was te wyte aan die hoë kompressie van die datastel, wat gelei het tot minder ongeskonde mikrotubules. Let daarop dat hierdie datastel bestaan ​​uit 'n mengsel van mikrotubule -dubbels en drielinge. Ons het gekies om ook subtomogramme te gebruik wat MTD's bevat met die wete dat die innerlike struktuur in die mens steeds aan hulle geheg is (fig. S2A). Hierdie heterogeniteit van die datastel verduidelik die swak C-mikrotubule rekonstruksie (fig. S6, I en J).

Vir die aansluitings tussen die MTT's in ongekomprimeerde P. tetraurelia en C. reinhardtii sentriole, is die subtomogramme soos voorheen gegenereer, maar die volgorde van puntpluk was eers C-mikrotubules en dan A-mikrotubules. Dit is gedoen om die punte tussen twee MTT'e te interpoleer in plaas van die punte wat in die middel van die MTT geposisioneer is soos voorheen gedoen. Vir P. tetraurelia, 2413 subtomogramme is elke 8.5 nm uit die nege sentriole wat as die minste saamgepers is (rondste omtrek) onttrek. Om te kontroleer of daar 'n 17 nm-periodisiteit by die aansluiting is, is die helfte van die datastel gebruik, wat een deeltjie elke 17 nm simuleer. 'N Voorlopige gemiddelde is gegenereer uit die voorafbelyningsparameters en gebruik as die aanvanklike verwysing. Na vyf iterasies het die gemiddeld gegenereer geen 17-nm periodieke strukture aangebied nie, so ons het besluit om die volledige datastel met 8.5-nm periodisiteit te gebruik. Vir C. reinhardtii, Is 682 subtomogramme elke 17 nm uit vyf sentriole onttrek. In hierdie geval het voorlopige waarnemings reeds 'n periodisiteit rondom 16,2 nm aan die lig gebring (fig. S1T). Volg dieselfde prosedure as vir P. tetraurelia, is die aanvanklike verwysing gegenereer deur middel van gemiddelde subtomogramme met hul voorafbelynde parameters.

Kombinasie van kaarte

Om 'n kaart te genereer met twee aangrensende MTT's wat aan mekaar gekoppel is, gebruik ons ​​twee MTT -kaarte en een aansluitingskaart wat gegenereer word deur middel van subtomogramme soos hierbo beskryf. Die pixelintensiteite van al drie kaarte is eers genormaliseer tot dieselfde waardesreeks. Die drie kaarte is rofweg heroriënteer in volumes wat groot genoeg is om twee MTT's te pas [fig. S4M, a]. Daarna is die aansluitvolume in lyn gebring met die eerste MTT [fig. S4M, b] met behulp van SPIDER (37). Net so is die tweede MTT in lyn gebring met die nuwe aansluitingsvolume [fig. S4M, c]. Uit elke volume is 'n streek van belang in ImageJ gekies, en óf die MTT óf die aansluiting is uitgesegmenteer [fig. S4M, d]. Laastens is die drie gesegmenteerde volumes saamgevoeg met die hulpmiddel "Image Calculator -& gt Add" in ImageJ [fig. S4M, e]. Datalêers S1 en S2 is die finale .tiff-lêers van die saamgevoegde volumes vir P. tetraurelia (datalêer S1) en C. reinhardtii (datalêer S2).

Verspreidingsanalise van strukturele kenmerke

Om te verstaan ​​hoe die binneste steier en die A-C-skakelaar langs die sentrioollengte versprei is, het ons ImageJ gebruik om die posisies te kies waar die volgende strukture sigbaar begin word en waar hulle verdwyn: binneste steier, A-C-skakelaar, MTT's en MTD's.

Meetkundige ontleding

Van P. tetraurelia, het ons 10 sentriole gekies wat so ongeskonde (rond) as moontlik was. Om die kwessie van sentrioollengteveranderlikheid te vermy, is sentriole in 10 dele onderverdeel. Om dit te kan doen, is die "groep Z -projeksie" -hulpmiddel van ImageJ gebruik om 10 snye langs die middelpunt te genereer. By elke sny is A-, B- en C-mikrotubulus koördinate gekies. Langs die sentriolêre lengte het ons die middelpunt van die sentriole (O) gedefinieer as die barisentrum van alle A-mikrotubulus-koördinate. Dan, vir elke MTT, is die draaihoek bereken as die hoek tussen die vektor O-A en die vektor A-B (A en B is onderskeidelik die middelpunte van die A- en B-mikrotubuli). Boonop is die radius van die sentriole gemeet as die afstand O-A. Uit 10 sentriole, 9 MTT's en 10 onderafdelings, het ons twee ontbrekende waardes gehad, wat 898 metings vir elke parameter tot gevolg gehad het.

Van C. reinhardtii, is dieselfde inligting uit ses sentriole onttrek. Aangesien hierdie sentriole onvolledig was as gevolg van die FIB-maal, was dit nie moontlik om die barysentrum van die A-mikrotubules vir elke onderafdeling te bereken nie. Daarom het ons ook die hipotetiese posisie van die sentriole sentrum gekies. 'N Totale aantal 377 metings is verkry.

Rotasie- en translasieanalise

In 'n rou tomogram is 'n deursnit met 'n dikte van 100 nm onttrek uit 'n sentriole van P. tetraurelia. Om die kontras daarvan te verhoog, is die volume met 'n faktor van 2 ingegooi. Vervolgens is die geraas verwyder deur nie-lineêre anisotropiese diffusie met behulp van bsoft en deur 'n 3D Gaussiese filter met Fidji toe te pas. Met behulp van SPIDER is die volume langs die Z as elke pixel van -58 tot +58 (onderskeidelik -41 tot 41 nm). Terselfdertyd is die volume om die gedraai Z as met 5 ° van 0 tot 360. Elke vertaalde volume (met gekoppelde verskuiwings en rotasies) is vergelyk met die aanvanklike volume. Let daarop dat die kruiskorrelasie slegs op die binneste kernstruktuur bereken is. Dieselfde operasies is uitgevoer met behulp van 'n deursnit van die finale rekonstrueer P. tetraurelia binneste steier.

Op 'n soortgelyke wyse word 'n deursnit van C. reinhardtii sentriole is onttrek en voorberei. Aangesien sentriole verkry by FIB -maalwerk nie volledig is nie, kon die rotasie -analise nie betroubaar uitgevoer word nie. Ons kan egter 'n translasie-analise uitvoer soos hierbo verduidelik vir die rou tomogram en die finale gerekonstrueerde C. reinhardtii binneste steier.

Soogdierselkultuur

Selle is gekweek óf in RPMI-1640 en GlutaMAX (Life Technologies) (KE-37) óf Dulbecco se gemodifiseerde Eagle-medium en GlutaMAX [U2OS en HEK293 (menslike embrioniese nier – 293)], aangevul met 10% fetale kalfserum (Life Technologies) en penisillien en streptomisien (100 ug/ml).

Kloning

Die pEGFP-C1-Centrin-2-konstruk wat menslike sentrien-2 uitdruk (NM_004344.1) is elders beskryf (38). Vir die pEGFP-C2-POC5 konstruk, die vollengte koderingsvolgorde van hPOC5 verkry deur omgekeerde transkripsie polimerase kettingreaksie (RT-PCR) soos beskryf in (21) is in pEGFP-C2 (Clontech Laboratories) gekloneer. Die pmCherry-hPOC5 konstruk is verkry deur die groen fluoresserende proteïen (GFP) koderende volgorde in die vorige konstruk met mCherry te vervang. Om die GFP-FAM161A-konstruk te genereer, is menslike FAM161A (NM_001201543.2) is PCR-geamplifiseer vanaf die DKFZp686O21143Q komplementêre DNA (cDNA) kloon en in pEGFP-C2 gekloneer. Die pEGFP-POC1B-konstruk is gegenereer deur die koderingsvolgorde van menslike POC1B (NM_172240) van 'n Gateway-skenkervektor (ORFeome Collaboration Clones, beskikbaar by Dharmacon, ID: 100070629) in pEGFPC-attR, 'n aangepaste pEGFP-C2-vektor wat 'n Gateway-kloningskasset bevat. Die pmCherry-POC1B is op dieselfde wyse verkry deur gebruik te maak van pmCherryC-attR, 'n vektor afgelei van pEGPC-attR deur die GFP-koderingsreeks te vervang deur mCherry.

Coimmunop presipitasie eksperimente

Die volgende konstruksies is oorgedra in 'n 10 cm-skottel wat 30 tot 40% saamvloeiende HEK293-selle bevat met Lipofectamine (Life Technologies) of jetPRIME-reagens (Polyplus-transfeksie) volgens die instruksies van die vervaardiger: GFP-FAM161A met mCherry-POC5, mCherry-POC5 alleen, GFP – Centrin-2 met mCherry-FAM161A, en GFP-POC5 met mcherry-POC1B. Na 24 uur se uitdrukking, is selle verwerk volgens die GFP-Trap Kit (Chromotek) instruksies met behulp van radioimmunoprecipitasie-assay (RIPA) buffer vir die lys en die lisaat met GFP-Trap magnetiese krale vir 2 uur by 4 ° C geïnkubeer wiel. Monsters is op 'n 4 tot 20% gradiëntgel (Bio-Rad) uitgevoer voor oordrag op polivinielideendifluoried (PVDF) membraan deur gebruik te maak van die iBlot-stelsel (Invitrogen/Thermo Fisher Scientific). Membrane is óf geïnkubeer met primêre teenliggaampies teen muis GFP (1:700 Abcam, ab1218) óf konyn mCherry (1:500 Abcam, ab167453), gevolg deur bok anti-muis peperwortelperoksidase (HRP) (1:1000 van 'n 50% gliserol) voorraad Thermo Fisher Scientific, 31431) of bok anti-konyn HRP (1: 1000 uit 'n 50% glycerol voorraad Thermo Fisher Scientific, 31468) sekondêre teenliggaampies. Blots is ontwikkel met behulp van Amersham -films (GE Healthcare, 28906836).

FAM161A teenliggaamproduksie en suiwering

Om die anti-FAM161A teenliggaam te genereer, is 'n fragment wat vir aminosure 1 tot 160 kodeer (gebaseer op volgorde NP_001188472) in pGST-Parallel1 ingevoeg en uitgedruk in Escherichia coli. Die GST-FAM161A-samesmeltingsproteïen is onder inheemse toestande gesuiwer met Glutathione Sepharose 4 Fast Flow (GE Healthcare), versamel uit die krale deur TEV (Tobacco Etch Virus) proteasekloof en gebruik vir konynimmunisering (Agro-Bio). Teenliggaampies is daarna affiniteit gesuiwer oor 'n kolom GST-FAM161A wat op Affi-Gel 10 (Bio-Rad Laboratories) geïmmobiliseer is.

U-ExM reagense en protokol

U-ExM reagense word beskryf in (16) behalwe poli -d -lysien, wat by Thermo Fisher Fisher (A3890401) gekoop is. U-ExM monomeeroplossings (U-ExM – MS) is soos volg voorberei: Vir een gel, 25 ul natriumakrylaat (SA) uit 'n 38% (w/w, verdun met nukleasevrye water) voorraadoplossing, 12,5 ul van akrylamied (AA) uit 'n 40% voorraadoplossing, 2,5 ul bis-akrielamied (BIS) uit 'n 2% voorraadoplossing en 5 ul 10 × fosfaatgebufferde soutoplossing (PBS) is vooraf gemeng en gehou by -20 ° C . Vry-radikaal inisieerder ammonium per sulfaat (APS) en polimerisasie katalisator tetrametieletileendiamien (TEMED) is voorberei as 10% voorraadoplossings in nuklease-vrye water en gehou as aliquots by -20°C vir 1 maand.

Die volgende primêre teenliggaampies is in hierdie studie gebruik: konyn-anti-tubulien (1: 500, Abcam, ab18251), konyn poliklonale anti-poliglutamaatketting (PolyE, IN105) (1: 500 AG-25B-0030-C050, AdipoGen), tubulien teenliggaampies AA344 (1: 250: scFv-S11B, β-tubulin) en AA345 (1: 250 scFv-F2C, α-tubulin), polyklonale konyn anti-POC1B (1: 250 PA5-24495, Thermo Fisher Scientific), konyn poliklonale anti-POC5 (1:250 A303-341A, Bethyl Laboratories), konyn poliklonale anti-FAM161A (1:250 tuisgemaakte teenliggaampies, hierdie studie), en muis monoklonale anti-Centrin-2 (1:250 kloon 20H5, 04-162 , Merck Millipore). Ons het die volgende sekondêre teenliggaampies gebruik: bok anti-konyn Alexa Fluor 488 immunoglobulien G (IgG) swaar + lig (H + L) (1:400 A11008), bok anti-muis Alexa Fluor 488 IgG H + L (1:400 A11029 ), bok anti-muis Alexa Fluor 568 IgG H + L (1: 400 A11004) (1: 400 Invitrogen, Thermo Fisher Scientific), en bok anti-konyn Alexa Fluor 568 (1: 400 Thermo Fisher Scientific).

Die U-ExM-protokol is uitgevoer soos beskryf (16). Kortliks, 12-mm dekstrokies met ongefikseerde U2OS-selle is vir 5 uur by 37°C in 'n oplossing van formaldehied (FA) en AA (sien Materiale en Metodes vir konsentrasie) in PBS geïnkubeer. TEMED (2.5 μl) en APS (2.5 μl) (vanaf 10% voorraadoplossings) is by die U-ExM–MS gevoeg en vinnig gemeng voordat dit by die dekstrokies gevoeg is. Gelasie word toegelaat om vir 5 minute op ys te verloop en word dan vir 1 uur in die donker na 37 ° C beweeg. Dekstrokies met gels word vervolgens in denaturasiebuffer (200 mM SDS, 200 mM NaCl en 50 mM tris in ddH geïnkubeer)2O bi-gedistilleerde water) vir 15 minute by kamertemperatuur (RT) met sagte roering. Opeenvolgend is gels van die dekstrokies verwyder en verder geïnkubeer met vars denatureringsbuffer by 95°C vir 90 min (tensy gespesifiseer, sien fig. S8). Na denaturering is gels in ddH gedompel2O by RT. Vervolgens is gels in ddH geïnkubeer2O oornag vir volledige uitbreiding. Die volgende dag is gels twee keer vir 15 minute in PBS gewas om oortollige water te verwyder voor inkubasie met primêre teenliggaamoplossing. Inkubasie met primêre teenliggaampies verdun in 2% PBS/BSA is uitgevoer by 37°C vir

3 uur, met sagte skud. Gels is daarna gewas in PBS en 0,1% Tween 20 (PBST), drie keer gedurende 10 minute met skud, en geïnkubeer met sekondêre teenliggaamoplossing verdun in 2% PBS/BSA vir

3 uur by 37°C, met sagte skud. Jelle is dan in PBST gewas, drie keer vir 10 min met skud, en laastens in bekers gevul met ddH geplaas2O vir die finale uitbreiding eers vir 30 minute en dan oornag vir volledige uitbreiding. Verwagte uitbreiding wissel van 4 tot 4,2 ×. Montering is uitgevoer soos beskryf (16).

U-ExM-protokoloptimalisering en beeldverkryging

Ons het ons voorheen beskryfde U-ExM protokol (16) om beter uitbreiding van sentriole binne menslike selle te verkry. Twee stappe is soos volg gewysig: die oplossing van FA/AA [FA 0.7 en 1% AA = 1X (16) FA 1.4 en 2% AA = 2X en FA 2.1 en 3% AA = 3X) en die denatureringstyd (30, 60 en 90 min). Die resultate van die optimalisering word in fig. S8 (A en B). Die 2X-protokol gekombineer met denaturasie van 90 minute by 95 ° C het die beste uitbreiding opgelewer en is vir verdere analise gebruik.

Konfokale mikroskopie is uitgevoer op 'n Leica TCS SP8 met behulp van 'n oliedoelwit van 63 × 1,4 numeriese diafragma (NA), met die weerligmodus op 'n maksimum resolusie om ontkoppelde beelde te genereer, met die volgende parameters: Weerlig met maksimum resolusie, aanpasbaar as 'strategie' en water as 'monteermedium'. 3D Z stapels is verkry met 0,12 μm Z tussenposes en 'n x,y pixelgrootte van 35 nm. Vir fig. S8 (A en B), is sentriole afgebeeld met 'n 100 × 1,25 NA N PLAN-oliedoelwit op 'n Leica DM6B-veldveldmikroskoop, toegerus met 'n wetenskaplike komplementêre metaaloksied-halfgeleier (sCMOS) monochrome Leica DFC9000-kamera. Ontwikkelde beelde is gegenereer met die Thunder "Small volume computational clearing" -modus.

Mates van sentriool deursnee en lengte

Die deursnee en lengte van tubulien en binneste steierproteïene is altyd gemeet aan die hand van dubbele kleureksperimente om relatiewe waardes te verkry. Sentriole met hul distale en proksimale punte vertikaal langs die Z as is gekies vir deursnee -analise. Die diameters van tubulien en die verskillende binneste steierproteïene is in die middel gemeet Z vliegtuig deur die Fidji-lynskandering en plotprofielnutsmiddels te gebruik (39) om die afstand tussen die twee intensiteitspieke te meet. Vir elke sentriole is diameters van proteïenlokalisering verkry uit die gemiddelde van twee loodregte metings.Vir lengte-analise, slegs sentriole lê byna parallel aan die x,y vliegtuig gekies om die lengte van tubulien en die verskillende binnekernproteïene te meet. Vir elke sentriole is 'n lynskandering oor die hele breedte van die middelpunt geteken langs 'n maksimum projeksiebeeld wat gegenereer word uit 'n paar middelvlakke van die middelpunt. Die Fiji -plotprofielgereedskap is daarna gebruik om die fluorescentie -intensiteitsprofiel van beide tubulien en die binnekernproteïen uit dieselfde lynskandering te verkry, en lengte is gemeet as die afstand tussen 50% intensiteit van die mees proksimale piek en die 50% intensiteit van die mees distale piek.

Om die grafieke in fig. S8 (C, E, G en I), beide die x en y asse is herskaal na relatiewe eenhede. Vir elke tubulien fluoressensie intensiteit profiel, die hoogste maksimum fluoressensie waarde (x as) na 1 verander, en al die ander waardes is genormaliseer. Boonop is die lengtes van elke fluorescentie -intensiteitsprofiel (y as) is tussen 0 en 1 herskaal deur 0 tot 5% van die fluorescentie -intensiteit van die mees proximale piek en 1 tot 5% van die fluorescentie -intensiteit van die mees distale piek toe te ken. Vervolgens word die grootte van tubulienfluoressensie -intensiteitprofiele hergroei

60 sentriole van drie onafhanklike gels was in lyn en gemiddeld saam om 'n gemiddelde kromme te genereer. Die fluorescentie -intensiteitsprofiel van elke binneste steierproteïen is op dieselfde manier genormaliseer en herskaal deur sy eie maksimum intensiteit op die x as en deur die lengte van die ooreenstemmende tubulienprofiel vanaf dieselfde sentriool op die y as. Vervolgens is die belynde intensiteitsprofiele van die binneste steierproteïene saam gemiddeld om gemiddelde kurwes te genereer. Die fluorescentie -intensiteitprofiele is herskaal deur die taal R te gebruik en in GraphPad Prism7 geteken.

Om Fig. 4 (K en L) te verkry, is diameters van binneste steierproteïene en tubulien van elke individuele sentriool genormaliseer na die gemiddelde tubulienmetings verkry vanaf al die sentriole. Individuele waardes is geteken as 'n sirkel van die ooreenstemmende deursnee en in lyn met die middel.

Simmetrisasie

Gesimetriseerde beelde (Fig. 4J) is verkry uit die ontbindde konfokale samesmeltingsbeelde wat in Fig. 4I (rou beelde) getoon word. Elke beeld is nege keer gedupliseer en opeenvolgend met 'n hoek van 40 ° in Fidji gedraai (39). Deur die Fiji -inprop StackReg te gebruik, is die gedraaide beelde slegs deur vertalings op die oorspronklike beeld aangepas. 'N Gemiddelde projeksie van die nege beelde is daarna gegenereer.

Binnesteier by U-ExM-resolusie

Soos beskryf in fig. S9 (F tot K), 2D projeksie (gemiddeld) (fig. S9F) van die gerekonstrueerde 3D cryo-EM kaart is gegenereer met behulp van Fidji (39). Daarna is die beeld vier keer groter verander om die grootte van 'n sentriole in U-ExM te bereik (ongeveer 800 nm in deursnee van die middel van die MTT's). Vervolgens is twee beelde gegenereer deur óf die binneste steierdigtheid (fig. S9G) óf die MTT's (fig. S9H) te skrap. Elke beeld is daarna met 'n bandpas in die Fourier -ruimte verwerk deur die klein strukture tot 140 nm te filter, wat ooreenstem met die konfokale resolusie na dekonvolusie (fig. S9, I en J). Die finale beeld is geskep deur die twee gefiltreerde beelde saam te voeg (fig. S9K).

Mikrotubule werwingsbepaling

Sestig tot 80% samelopende U2OS-selle is met behulp van jetPRIME-reagens (Polyplus-transfeksie) met behulp van jetPRIME-reagens in 'n sesput-plaat getransfekteer, met 2,5 μg totale DNA van die volgende kombinasies: mCherry-FAM161A alleen, GFP-POC5 alleen, GFP -POC1B alleen, GFP – Centrin-2 alleen, mCherry-FAM161A met GFP-POC5, mCherry-FAM161A met GFP-POC1B, mCherry-FAM161A met GFP – Centrin-2, mcherry-POC5 met GFP – Centrin-2, of mCherry- FAM161A met beide mCherry-POC5 en GFP – Centrin-2. Die medium is 4 tot 6 uur na transfeksie verander om seldood te vermy, en uitdrukking van die fluoresserende samesmeltingsproteïene is vir 24 uur toegelaat. Selle wat op dekstrokies gekweek is, is dan vir 3 minute in −20°C koue MeOH vasgemaak en een keer in PBS gewas voordat dit vir α- en β-tubuliene gekleur is (sien "U-ExM reagense" afdeling in die Aanvullende Materiaal) in PBS/BSA 2 % gevolg deur anti-muis STAR RED sekondêre teenliggaam (1: 400 Abberior), drie keer gewas in PBS Tween 0,1%. Dekstrokies is dan gemonteer deur gebruik te maak van gliserol-monteermedium met 4',6-diamidino-2-fenielindool en DABCO 1, 4-diazabisiklo (2.2.2) oktaan (Abcam, ab188804).


Bespreking

Daar is getoon dat sintetiese peptiede afkomstig van die funksionele domeine van virale geenprodukte die ooreenstemmende virusse rem (19–21). Byvoorbeeld, 'n 36-aa-peptied, wat ooreenstem met 'n heptad-herhalingsvolgorde in die MIV-1-transmembraanglikoproteïen (gp41), is 'n kragtige inhibeerder van MIV-1-membraansamesmelting en virusinskrywing (20, 22, 23) en is nou in kliniese gebruik in MIV-1-geïnfekteerde pasiënte (24). Interessant genoeg, inhibeer die N-terminale proteolitiese splitsingsproduk van 'n peptied wat oor die NS5A-NS5B-splitsingsplek in HCV strek, die HCV NS3/4A-protease, en 'n peptidomimentiese makrosikliese verbinding gebaseer op die struktuur het 'n kragtige antivirale aktiwiteit in vitro en by mense (19). Hierdie en soortgelyke resultate in ander virusstelsels (21,25) was die dryfveer vir die studies wat hierin gerapporteer is.

Deur gebruik te maak van 'n aansteeklike fokusverminderingstoets om 'n sintetiese peptiedbiblioteek van 441 lede wat die HCV-poliproteïen dek, te skerm, het ons 13 peptiede geïdentifiseer wat HCV-infeksie minstens 10-voudig geïnhibeer het, waarvan die sterkste infeksie >100,000-voudig geblokkeer het. Verskeie van hierdie peptiede het potensieel uiteenlopende meganismes van werking, gebaseer op hul ligging in die ooreenstemmende proteïen (Fig. 1, SI Tabel 3). Die sterkste van hierdie peptiede, C5A, 'n 18-mer, afgelei van die membraankerdomein van die HCV NS5A-proteïen waarvan die IC50 is in die nanomolêre reeks, wat minstens 100-voudig laer is as die toksiese dosis wat waargeneem word in vitro en in vivo in muise (SI Tabel 4), is vir verdere analise geselekteer. Dit is belangrik dat C5A se d -isomeer minstens so sterk is as die l -isomeer (Fig. 2), minder sitotoksies is in vitro (Fig. 2), is stabiel in serumbevattende medium (SI Fig. 5) en is nie-immunogeen in vivo (data word nie getoon nie). Boonop vertoon C5A 'n heeltemal unieke antivirale werkingsmeganisme: dit destabiliseer virale strukturele integriteit en het virale membranolitiese aktiwiteit, dit wil sê, dit is virododend. Dit is dus nie verbasend dat C5A heeltemal en permanent voorkom nie De novo HCV -infeksie en onderdruk deurlopende HCV -infeksie in verdelende en nie -verdeel selle. Gesamentlik dui hierdie resultate daarop dat C5A HCV -infeksie inhibeer deur HCV -virions ekstrasellulêr en binne besmette selle te destabiliseer.

C5A is saamgestel uit aminosure 3-20 by die N-terminus van NS5A, 'n gefosforileerde sinkmetalloproteïen wat 'n noodsaaklike komponent van die HCV-replikasiekompleks is (26, 27). Die N-terminale 30 aminosure van NS5A dien as sy membraananker en rig die proteïen na die endoplasmiese retikulum (ER) (28). Strukturele analise dui aan dat hierdie streek 'n amfipatiese α-heliks vorm wat in die vlak ingeslote is in die sitosoliese pamflet van die membraan-tweelaag (13, 31). Soos verwag, onthul CD-analise dat C5A α-heliese struktuur in waterige oplossing vertoon. Net so het heliese wielprojeksies getoon dat C5A-reste in 'n perfekte amfipatiese patroon versprei is (SI Fig. 6). Nietemin, C5A se antivirale aktiwiteit is nie 'n algemene eienskap van alle membraanassosiasiedomeine nie, want peptiede van die membraanankerdomeine van ander HCV niestrukturele proteïene [bv. NS4A, NS4B en NS5B (29)] wat in ons peptied-siftingspaneel teenwoordig is, inhibeer nie HCV infeksie.

Struktuuraktiwiteit-analise het aan die lig gebring dat die antivirale spesifisiteit van C5A korreleer met sy α-helikale struktuur en sy vermoë om liposoommembrane te permeabiliseer. Hierdie resultate dui daarop dat C5A interaksie het met die virale membraan om die integriteit daarvan te versteur, virale kapsiede vry te stel en die virale genoom bloot te stel aan eksonukleas vir afbraak. Daarbenewens het mutasie-analise aan die lig gebring dat amfipatisiteit nodig is vir C5A se antivirale aktiwiteit. Hierdie unieke werkingsmeganisme onderskei C5A van peptiede wat inmeng met die interaksie van virale ligand -gasheer -reseptore [bv. Fuzeon en Virus Inhibitory Peptide (VIRIP) vir HIV EB -peptied vir griep] (20, 30, 31) en virale ontsnapping uit endosome (bv. , HNP1 en HD5 vir menslike papillomavirusse) (32). Alhoewel amfipatisiteit en α-helisiteit beide nodig is vir C5A se antivirale aktiwiteit, is dit nie voldoende nie, omdat verskeie ander amfipatiese α-heliese peptiede wat antimikrobiese aktiwiteit in ander stelsels het (33, 34) nie aktief is teen HCV nie.

Struktuur-aktiwiteitsanalise het ook aan die lig gebring dat C5A se antivirale aktiwiteit volgorde-onafhanklik is, omdat retropeptiede of peptiede met roere hidrofobiese of hidrofiliese aminosure ten volle aktief was, wat daarop dui dat die virosidale aktiwiteit daarvan onafhanklik is van spesifieke peptiedmembraan proteïeninteraksies. Dit word ondersteun deur die volle antivirale aktiwiteit van die d-isomeer van C5A, wat waarskynlik nie aan dieselfde spesifieke peptied-membraanproteïeninteraksies sal deelneem as sy l-isomeer-eweknie nie. In teenstelling hiermee het aminosuurvervangingsanalise aan die lig gebring dat die antivirale aktiwiteit van C5A afhang van die aminosuursamestelling daarvan, dat die interne sistienrest daarvan noodsaaklik blyk te wees en dat die positief gelaaide kongeners ook aktief is. Sintetiese analoë van C5A afkomstig van die prototipe-reeks van ses onafhanklike HCV-genotipes vertoon veranderlike antivirale aktiwiteit teen HCV ondanks die behoud van amfipatiese α-heliese struktuur, wat waarskynlik hul verskillende aminosure-samestelling weerspieël.

Interessant genoeg is die antivirale aktiwiteit van C5A nie beperk tot HCV nie, omdat dit kragtige antivirale aktiwiteit teen ander lede van die Flaviviridae (Wes-Nyl-virus en dengue-virus), paramyxovirusse (masels en respiratoriese sinsitiale virus), en MIV, waarvan die besonderhede afsonderlik gerapporteer sal word. Wat belangrik is, is dat voorlopige ontleding daarop dui dat C5A virosied is vir Dengue en MIV, soortgelyk aan HCV. Hierdie resultate ondersteun die idee dat C5A sellulêre komponente van virusmembrane teiken eerder as proteïenkodeerde proteïene. Gebaseer op sy in-vlak oriëntasie in die sitosoliese pamflet van die ER membraan (13), stel ons voor dat C5A herken sellulêre komponente van virus membrane, heel waarskynlik hul lipied samestelling, wat sal weerspieël dié van die sellulêre kompartement waarbinne hul morfogenese plaasvind. Omdat HCV-, West -Nyl -virus en dengue -virus in die ER bot, kan hul membrane die lipiedsamestelling weerspieël wat nodig is vir die insit van die membraanker van HCV NS5A. Daarteenoor bot masels, RSV en MIV van die oppervlak van besmette selle af, sodat die basis vir die inaktivering daarvan deur C5A nog bepaal moet word. Teoreties kan hulle bot deur lipiedvlotte, wat ryk is aan cholesterol en sfingolipiede (35), en kan dus soortgelyke membraanlipiedsamestelling as HCV bevat, wat ook getoon is om te assosieer met skoonmaakmiddel-weerstandige membrane in die sel (36, 37). ). Verdere studies is nodig om hierdie moontlikhede aan te spreek, sowel as die basis vir C5A -weerstand van die ander virusse wat in hierdie studie getoets is.

Ten slotte, hierdie studies het die virale membraan gedefinieer as teiken vir intervensie in sekere virusinfeksies. Boonop vestig hulle C5A as die prototipe van 'n klas antivirale middels wat spesifiek op die doelwit fokus. As sodanig kan membraangerigte middels soos C5A gekombineer word met middels wat intrasellulêre aspekte van die virale lewensiklus teiken. Dit is belangrik dat sulke middels nie vir ontsnappingsvariante gekies word nie, en as dit gekombineer word met middels wat weerstandsmutasies selekteer, moet die ekstrasellulêre virosidale werking daarvan ook die verspreiding van hierdie variante voorkom.


Inhoud

Proteïene is kettings van aminosure wat deur peptiedbindings aan mekaar verbind is. Baie konformasies van hierdie ketting is moontlik as gevolg van die rotasie van die ketting om elke alfa-koolstofatoom (Cα-atoom). Dit is hierdie konformasieveranderinge wat verantwoordelik is vir verskille in die driedimensionele struktuur van proteïene. Elke aminosuur in die ketting is polêr, dit wil sê, dit het positiewe en negatiewe gelaaide streke geskei met 'n vrye karbonielgroep, wat as waterstofbindingsakseptor kan dien en 'n NH -groep, wat as waterstofbindingsskenker kan optree. Hierdie groepe kan dus in die proteïenstruktuur interaksie hê. Die [ watter? ] 20 aminosure kan geklassifiseer word volgens die chemie van die syketting, wat ook 'n belangrike strukturele rol speel. Glycine neem 'n spesiale posisie in, aangesien dit die kleinste syketting het, slegs een waterstofatoom, en daarom die plaaslike buigbaarheid in die proteïenstruktuur kan verhoog. Sisteïen aan die ander kant kan met 'n ander sisteïenresidu reageer en daardeur 'n dwarsskakel vorm wat die hele struktuur stabiliseer. [ aanhaling nodig ]

Die proteïenstruktuur kan beskou word as 'n reeks sekondêre struktuurelemente, soos α-helices en β-velle, wat saam die algehele driedimensionele opset van die proteïenketting vorm. In hierdie sekondêre strukture word gereelde patrone van H-bindings tussen naburige aminosure gevorm, en die aminosure het soortgelyke Φ- en ψ-hoeke. [ aanhaling nodig ]

Die vorming van hierdie strukture neutraliseer die poolgroepe van elke aminosuur. Die sekondêre strukture is styf verpak in die proteïenkern in 'n hidrofobiese omgewing. Elke aminosuur -sygroep het 'n beperkte volume om in te neem en 'n beperkte aantal moontlike interaksies met ander nabye kettings, 'n situasie wat in berekening gebring moet word by molekulêre modellering en belyning. [1]

Α Helix Edit

Die a -heliks is die algemeenste tipe sekondêre struktuur in proteïene. Die α -heliks het 3,6 aminosure per beurt met 'n H -binding gevorm tussen elke vierde residu, die gemiddelde lengte is 10 aminosure (3 beurte) of 10 Å, maar wissel van 5 tot 40 (1,5 tot 11 beurte). Die belyning van die H-bindings skep 'n dipoolmoment vir die heliks met 'n gevolglike gedeeltelike positiewe lading aan die amino einde van die heliks. Omdat hierdie streek gratis NH het2 groepe, sal dit interaksie hê met negatief gelaaide groepe soos fosfate. Die mees algemene ligging van α -helices is op die oppervlak van proteïenkerne, waar dit 'n koppelvlak bied met die waterige omgewing. Die binnekant van die heliks bevat geneig om hidrofobiese aminosure te hê en die hidrofiliese aminosure aan die buitekant. Dus, elke derde van vier aminosure langs die ketting sal geneig wees om hidrofobies te wees, 'n patroon wat redelik maklik opgespoor kan word. In die leucine -ritsmotief is 'n herhalende patroon van leucines aan die voorkant van twee aangrensende helices baie voorspellend vir die motief. 'N Helikopterwiel kan gebruik word om hierdie herhaalde patroon aan te toon. Ander α -helices wat in die proteïenkern of in die selmembrane begrawe is, het 'n hoër en meer gereelde verspreiding van hidrofobiese aminosure en is baie voorspellend vir sulke strukture. Helices wat op die oppervlak blootgestel word, het 'n laer proporsie hidrofobiese aminosure. Aminosuurinhoud kan 'n α -heliese gebied voorspel. Streke wat ryker is aan alanien (A), glutamiensuur (E), leucine (L) en metionien (M) en armer in prolien (P), glisien (G), tyrosien (Y) en serien (S), is geneig om te vorm 'n α-heliks. Proline destabiliseer of breek 'n α -heliks, maar kan in langer helices voorkom en 'n buiging vorm.

Β blad Wysig

β -velle word gevorm deur H -bindings tussen gemiddeld 5-10 opeenvolgende aminosure in een gedeelte van die ketting en nog 5-10 verder in die ketting. Die wisselwerkende streke kan aangrensend wees, met 'n kort lus tussenin of ver uitmekaar, met ander strukture tussenin. Elke ketting kan in dieselfde rigting loop om 'n parallelle vel te vorm, elke ander ketting kan in die omgekeerde chemiese rigting loop om 'n anti -parallelle plaat te vorm, of die kettings kan parallel en anti -parallel wees om 'n gemengde vel te vorm. Die patroon van H-binding verskil in die parallelle en anti-parallelle konfigurasies. Elke aminosuur in die binneste stringe van die vel vorm twee H-bindings met naburige aminosure, terwyl elke aminosuur op die buite stringe slegs een binding met 'n binneste string vorm. As jy reghoekig na die stringe oor die vel kyk, word verder stringe effens antikloksgewys gedraai om 'n linkshandige draai te vorm. Die Cα-atome wissel bo en onder die vel in 'n geplooide struktuur, en die R-sygroepe van die aminosure wissel bo en onder die plooie. Die Φ en Ψ hoeke van die aminosure in velle verskil aansienlik in een streek van die Ramachandran plot. Dit is moeiliker om die ligging van β-blaaie te voorspel as van α-helices. Die situasie verbeter ietwat wanneer die aminosuurvariasie in veelvuldige volgordebelynings in ag geneem word.

Lusse wysig

Sommige dele van die proteïen het 'n vaste driedimensionele struktuur, maar vorm geen gereelde strukture nie. Hulle moet nie verwar word met afwykende of ontvoude segmente van proteïene of ewekansige spoel nie, 'n ontvoude polipeptiedketting sonder 'n vaste driedimensionele struktuur. Hierdie dele word dikwels "lusse" genoem omdat hulle β-velle en α-helikse verbind. Lusse is gewoonlik op die proteïenoppervlak geleë, en daarom word mutasies van hul residue makliker geduld. As u meer substitusies, invoegings en verwyderings in 'n sekere gebied van 'n volgordebelyning het, kan dit 'n aanduiding wees van 'n lus. Die posisies van introne in genomiese DNA kan korreleer met die liggings van lusse in die gekodeerde proteïen [ aanhaling nodig ]. Lusse is ook geneig om gelaaide en polêre aminosure te hê en is dikwels 'n komponent van aktiewe terreine.

Proteïene kan geklassifiseer word volgens beide strukturele en volgorde-ooreenkomste. Vir strukturele klassifikasie word die groottes en ruimtelike rangskikkings van sekondêre strukture wat in die paragraaf hierbo beskryf word, vergelyk in bekende driedimensionele strukture. Klassifikasie gebaseer op volgorde-ooreenkoms was histories die eerste wat gebruik is. Aanvanklik is ooreenkoms gebaseer op belynings van hele rye uitgevoer. Later is proteïene geklassifiseer op grond van die voorkoms van bewaarde aminosuurpatrone. Databasisse wat proteïene volgens een of meer van hierdie skemas klassifiseer, is beskikbaar. By die oorweging van proteïenklassifikasieskemas, is dit belangrik om verskeie waarnemings in gedagte te hou. Eerstens kan twee heeltemal verskillende proteïenvolgordes van verskillende evolusionêre oorsprong in 'n soortgelyke struktuur vou. Omgekeerd kan die volgorde van 'n antieke geen vir 'n gegewe struktuur aansienlik in verskillende spesies verskil, terwyl dieselfde basiese strukturele kenmerke terselfdertyd gehandhaaf is. Dit kan 'n baie moeilike taak wees om die oorblywende volgordeooreenkoms in sulke gevalle te erken. Tweedens, twee proteïene wat 'n beduidende mate van volgorde-ooreenkomste deel hetsy met mekaar of met 'n derde volgorde deel ook 'n evolusionêre oorsprong en behoort ook 'n paar strukturele kenmerke te deel.Gene duplisering en genetiese herrangskikkings tydens evolusie kan egter aanleiding gee tot nuwe geenkopieë, wat dan kan ontwikkel tot proteïene met nuwe funksie en struktuur. [1]

Terme wat gebruik word vir die klassifikasie van proteïenstrukture en rye Redigeer

Die meer algemeen gebruikte terme vir evolusionêre en strukturele verwantskappe tussen proteïene word hieronder gelys. Baie bykomende terme word gebruik vir verskeie soorte strukturele kenmerke wat in proteïene voorkom. Beskrywings van sulke terme kan gevind word by die CATH-webwerf, die Structurele Classification of Proteins (SCOP)-webwerf, en 'n Glaxo Wellcome-tutoriaal op die Switserse bioinformatika Expasy-webwerf.

Aktiewe plek 'n gelokaliseerde kombinasie van aminosuur-sygroepe binne die tersiêre (driedimensionele) of kwaternêre (proteïensubeenheid) struktuur wat in wisselwerking kan tree met 'n chemies spesifieke substraat en wat die proteïen van biologiese aktiwiteit voorsien. Proteïene van baie verskillende aminosuurvolgordes kan in 'n struktuur vou wat dieselfde aktiewe plek produseer. Argitektuur is die relatiewe oriëntasie van sekondêre strukture in 'n driedimensionele struktuur, ongeag of hulle 'n soortgelyke lusstruktuur het of nie. Vou (topologie) 'n tipe argitektuur wat ook 'n bewaarde lusstruktuur het. Blokke is 'n bewaarde aminosuurvolgordepatroon in 'n familie van proteïene. Die patroon bevat 'n reeks moontlike ooreenkomste op elke posisie in die voorgestelde rye, maar daar is geen ingevoegde of verwyderde posisies in die patroon of in die rye nie. In teenstelling hiermee is volgordeprofiele 'n tipe puntematriks wat 'n soortgelyke stel patrone verteenwoordig wat invoegings en skrappings insluit. Klas 'n term wat gebruik word om proteïendomeine te klassifiseer volgens hul sekondêre strukturele inhoud en organisasie. Vier klasse is oorspronklik erken deur Levitt en Chothia (1976), en verskeie ander is bygevoeg in die SCOP -databasis. Drie klasse word in die CATH-databasis gegee: hoofsaaklik-α, hoofsaaklik-β en α – β, met die α-β-klas wat beide afwisselende α/β- en α+β-strukture insluit. Kern die gedeelte van 'n gevoude proteïenmolekule wat die hidrofobiese binnekant van α-helikse en β-velle bevat. Die kompakte struktuur bring sygroepe van aminosure so naby aan mekaar dat hulle in wisselwerking kan tree. Wanneer proteïenstrukture vergelyk word, soos in die SCOP-databasis, is kern die streek wat algemeen is vir die meeste van die strukture wat 'n gemeenskaplike vou deel of wat in dieselfde superfamilie is. In struktuurvoorspelling word kern soms gedefinieer as die rangskikking van sekondêre strukture wat waarskynlik tydens evolusionêre verandering bewaar sal word. Domein (volgordekonteks) 'n segment van 'n polipeptiedketting wat in 'n driedimensionele struktuur kan vou, ongeag die teenwoordigheid van ander segmente van die ketting. Die afsonderlike domeine van 'n gegewe proteïen kan grootliks interaksie hê of slegs deur 'n lengte van die polipeptiedketting verbind word. 'n Proteïen met verskeie domeine kan hierdie domeine gebruik vir funksionele interaksies met verskillende molekules. Familie (volgordekonteks) 'n groep proteïene met 'n soortgelyke biochemiese funksie wat meer as 50% identies is wanneer dit in lyn gebring word. Dieselfde afsnypunt word steeds deur die Proteïeninligtingshulpbron (PIR) gebruik. 'N Proteïenfamilie bestaan ​​uit proteïene met dieselfde funksie in verskillende organismes (ortoloë rye), maar kan ook proteïene in dieselfde organisme insluit (paralogiese rye) afkomstig van geen duplisering en herrangskikkings. As 'n veelvuldige volgordebelyning van 'n proteïenfamilie 'n algemene ooreenkoms oor die lengte van die proteïene toon, verwys PIR na die gesin as 'n homeomorfe familie. Daar word na die belynde streek verwys as 'n homeomorfiese domein, en hierdie streek kan verskeie kleiner homologiedomeine bevat wat met ander families gedeel word. Gesinne kan verder onderverdeel word in subfamilies of in superfamilies gegroepeer word op grond van die onderskeie hoër of laer vlakke van volgorde -ooreenkoms. Die SCOP -databasis rapporteer 1296 gesinne en die CATH -databasis (weergawe 1.7 beta), rapporteer 1846 gesinne. Wanneer die volgordes van proteïene met dieselfde funksie in groter besonderhede ondersoek word, word gevind dat sommige hoë volgorde-ooreenkomste deel. Hulle is natuurlik lede van dieselfde familie volgens die bogenoemde kriteria. Ander word egter gevind wat baie min, of selfs onbeduidende, volgorde-ooreenkoms met ander familielede het. In sulke gevalle kan die gesinsverhouding tussen twee verre familielede A en C dikwels gedemonstreer word deur 'n bykomende gesinslid B te vind wat aansienlik ooreenstem met beide A en C. So bied B 'n verbindende skakel tussen A en C. 'n Ander benadering is om verre belynings vir sterk bewaarde vuurhoutjies te ondersoek. By 'n identiteitsvlak van 50%sal proteïene waarskynlik dieselfde driedimensionele struktuur hê, en die identiese atome in die volgordebelyning sal ook binne ongeveer 1 Å in die strukturele model plaas. As die struktuur van een lid van 'n gesin dus bekend is, kan 'n betroubare voorspelling gemaak word vir 'n tweede familielid, en hoe hoër die identiteitsvlak, hoe betroubaarder is die voorspelling. Proteïenstruktuurmodellering kan uitgevoer word deur te ondersoek hoe goed die aminosuurvervangings in die kern van die driedimensionele struktuur pas. Familie (strukturele konteks) soos gebruik in die FSSP databasis (Families of struktureel soortgelyke proteïene) en die DALI/FSSP webwerf, twee strukture wat 'n beduidende vlak van strukturele ooreenkoms het, maar nie noodwendig beduidende volgorde ooreenkoms nie. Vou soortgelyk aan struktuurmotief, bevat 'n groter kombinasie van sekondêre struktureenhede in dieselfde opset. Proteïene wat dieselfde vou deel, het dus dieselfde kombinasie van sekondêre strukture wat met soortgelyke lusse verbind is. 'N Voorbeeld is die Rossman -vou wat verskeie afwisselende α helices en parallelle β stringe bevat. In die SCOP-, CATH- en FSSP-databasisse is die bekende proteïenstrukture geklassifiseer in hiërargiese vlakke van strukturele kompleksiteit met die vou as 'n basiese vlak van klassifikasie. Homoloë domein (volgordekonteks) 'n uitgebreide volgordepatroon, algemeen aangetref deur volgordebelyningsmetodes, wat 'n algemene evolusionêre oorsprong onder die belynde rye aandui. 'N Homologiedomein is oor die algemeen langer as motiewe. Die domein kan 'n gegewe proteïenvolgorde of slegs 'n gedeelte van die ry insluit. Sommige gebiede is kompleks en bestaan ​​uit verskeie kleiner homologiedomeine wat tydens evolusie saamgevoeg is om 'n groter gebied te vorm. 'n Domein wat 'n hele reeks dek, word die homeomorfiese domein deur PIR (Protein Information Resource) genoem. Moduleer 'n gebied van bewaarde aminosuurpatrone wat een of meer motiewe bevat en beskou word as 'n fundamentele eenheid van struktuur of funksie. Die teenwoordigheid van 'n module is ook gebruik om proteïene in families te klassifiseer. Motief (volgordekonteks) 'n bewaarde patroon van aminosure wat in twee of meer proteïene voorkom. In die Prosite -katalogus is 'n motief 'n aminosuurpatroon wat voorkom in 'n groep proteïene met 'n soortgelyke biochemiese aktiwiteit, en wat dikwels naby die aktiewe plek van die proteïen is. Voorbeelde van volgorde -motiefdatabasisse is die Prosite -katalogus en die Stanford -motiefdatabasis. [2] Motief (strukturele konteks) 'n kombinasie van verskeie sekondêre strukturele elemente wat gevorm word deur die vou van aangrensende dele van die polipeptiedketting in 'n spesifieke driedimensionele opset. 'n Voorbeeld is die helix-lus-heliks-motief. Daar word ook na strukturele motiewe verwys as supersekondêre strukture en voue. Posisiespesifieke puntematriks (volgordekonteks, ook bekend as gewig of puntmatriks) verteenwoordig 'n bewaarde gebied in 'n veelvuldige volgordebelyning sonder gapings. Elke matrikskolom verteenwoordig die variasie wat in een kolom van die veelvuldige volgordebelyning voorkom. Posisiespesifieke puntematriks—3D (strukturele konteks) verteenwoordig die aminosuurvariasie wat gevind word in 'n belyning van proteïene wat in dieselfde strukturele klas val. Matrikskolomme verteenwoordig die aminosuurvariasie wat op een aminosuurposisie in die belynde strukture voorkom. Primêre struktuur die lineêre aminosuurvolgorde van 'n proteïen, wat chemies 'n polipeptiedketting is wat saamgestel is uit aminosure wat deur peptiedbindings verbind is. Profiel (volgordekonteks) 'n puntematriks wat 'n meervoudige volgorde-belyning van 'n proteïenfamilie verteenwoordig. Die profiel word gewoonlik verkry vanaf 'n goed bewaarde streek in 'n meervoudige volgorde belyning. Die profiel is in die vorm van 'n matriks met elke kolom wat 'n posisie in die belyning verteenwoordig en elke ry een van die aminosure. Matrikswaardes gee die waarskynlikheid van elke aminosuur op die ooreenstemmende posisie in die belyning aan. Die profiel word langs die teikenvolgorde geskuif om die beste puntetellingstreke op te spoor deur 'n dinamiese programmeringsalgoritme. Gapings word toegelaat tydens wedstryd en 'n gapingstraf word in hierdie geval ingesluit as 'n negatiewe telling as geen aminosuur ooreenstem nie. 'n Volgordeprofiel kan ook voorgestel word deur 'n versteekte Markov-model, waarna verwys word as 'n profiel HMM. Profiel (strukturele konteks) 'n puntmatriks wat voorstel watter aminosure goed moet pas en wat swak moet pas by opeenvolgende posisies in 'n bekende proteïenstruktuur. Profielkolomme verteenwoordig opeenvolgende posisies in die struktuur, en profielrye verteenwoordig die 20 aminosure. Soos met 'n volgordeprofiel, word die strukturele profiel langs 'n doelwitreeks verskuif om die hoogste moontlike belyningstempo deur 'n dinamiese programmeringsalgoritme te vind. Gapings kan ingesluit word en 'n boete ontvang. Die gevolglike telling verskaf 'n aanduiding of die teikenproteïen so 'n struktuur kan aanneem of nie. Kwaternêre struktuur die driedimensionele konfigurasie van 'n proteïenmolekule wat verskeie onafhanklike polipeptiedkettings bevat. Sekondêre struktuur van die interaksies tussen die C-, O- en NH-groepe op aminosure in 'n polipeptiedketting om α-helices, β-velle, draaie, lusse en ander vorme te vorm, wat die vou in 'n driedimensionele vorm vergemaklik struktuur. Superfamilie 'n groep proteïenfamilies van dieselfde of verskillende lengtes wat verwant is deur ver, maar waarneembare volgorde-ooreenkoms. Lede van 'n gegewe superfamilie het dus 'n gemeenskaplike evolusionêre oorsprong. Oorspronklik het Dayhoff die afsnypunt vir superfamiliestatus gedefinieer as die kans dat die rye nie verwant is van 10 6 nie, op grond van 'n belyningtelling (Dayhoff et al. 1978). Proteïene met min identiteite in 'n belyning van die rye, maar met 'n oortuigend algemene aantal strukturele en funksionele kenmerke, word in dieselfde superfamilie geplaas. Op die vlak van driedimensionele struktuur sal superfamilie-proteïene algemene strukturele kenmerke soos 'n gewone vou deel, maar daar kan ook verskille wees in die aantal en rangskikking van sekondêre strukture. Die PIR -bron gebruik die term homeomorfe superfamilies om te verwys na superfamilies wat saamgestel is uit rye wat van kant tot einde belyn kan word, wat 'n deling van enkelvolgorde homologie-domein verteenwoordig, 'n streek van ooreenkoms wat regdeur die belyning strek. Hierdie domein kan ook kleiner homologiedomeine bevat wat met ander proteïenfamilies en superfamilies gedeel word. Alhoewel 'n gegewe proteïenvolgorde domeine kan bevat wat in verskeie superfamilies gevind word, wat dus 'n komplekse evolusionêre geskiedenis aandui, sal rye aan slegs een homeomorfiese superfamilie toegeken word gebaseer op die teenwoordigheid van ooreenkomste regdeur 'n meervoudige volgordebelyning. Die superfamiliebelyning kan ook streke insluit wat nie binne of aan die einde van die belyning pas nie. In teenstelling hiermee pas rye in dieselfde familie goed regdeur die belyning. Supersekondêre struktuur 'n term met soortgelyke betekenis as 'n strukturele motief. Tersiêre struktuur is die driedimensionele of bolvormige struktuur wat gevorm word deur die bymekaarvou of vou van sekondêre strukture van 'n polipeptiedketting. [1]

Sekondêre struktuur voorspelling is 'n stel tegnieke in bioinformatika wat daarop gemik is om die plaaslike sekondêre strukture van proteïene te voorspel, slegs gebaseer op kennis van hul aminosuurvolgorde. Vir proteïene bestaan ​​'n voorspelling uit die toeken van streke van die aminosuurvolgorde as waarskynlike alfa-helikse, beta-stringe (dikwels genoem as "verlengde" konformasies), of draaie. Die sukses van 'n voorspelling word bepaal deur dit te vergelyk met die resultate van die DSSP -algoritme (of soortgelyke bv. STRIDE) wat op die kristalstruktuur van die proteïen toegepas word. Gespesialiseerde algoritmes is ontwikkel vir die opsporing van spesifieke goed gedefinieerde patrone, soos transmembraan helices en opgerolde spoele in proteïene. [1]

Daar word beweer dat die beste moderne metodes van sekondêre struktuurvoorspelling in proteïene 80% akkuraatheid bereik nadat masjienleer en volgordebelyning gebruik is [3] hierdie hoë akkuraatheid laat die voorspellings toe as 'n kenmerk wat vouherkenning en ab initio proteïenstruktuurvoorspelling, klassifikasie van strukturele motiewe en verfyning van volgordebelynings. Die akkuraatheid van huidige proteïen sekondêre struktuur voorspelling metodes word beoordeel in weeklikse maatstawwe soos LiveBench en EVA.

Agtergrond wysig

Vroeë metodes van voorspelling van sekondêre strukture, wat in die 1960's en vroeë 1970's bekendgestel is, [4] [5] [6] [7] [8] het gefokus op die identifisering van waarskynlike alfa-helices en was hoofsaaklik gebaseer op helix-coil-oorgangsmodelle. [9] Aansienlik meer akkurate voorspellings wat beta-blaaie ingesluit het, is in die 1970's bekendgestel en het staatgemaak op statistiese assesserings gebaseer op waarskynlikheidsparameters afgelei van bekende opgeloste strukture. Hierdie metodes, toegepas op 'n enkele reeks, is tipies hoogstens ongeveer 60-65% akkuraat, en ondervoorspel dikwels beta-blaaie. [1] Die evolusionêre bewaring van sekondêre strukture kan ontgin word deur gelyktydig baie homoloë volgordes in 'n meervoudige volgorde belyning te assesseer, deur die netto sekondêre struktuur geneigdheid van 'n belynde kolom aminosure te bereken. In ooreenstemming met groter databasisse van bekende proteïenstrukture en moderne masjienleermetodes soos neurale nette en ondersteuningsvektormasjiene, kan hierdie metodes tot 80% algehele akkuraatheid in bolvormige proteïene behaal. [10] Die teoretiese boonste grens van akkuraatheid is ongeveer 90%, [10] gedeeltelik as gevolg van eienaardighede in DSSP -opdrag naby die ente van sekondêre strukture, waar plaaslike konformasies onder inheemse omstandighede wissel, maar moontlik gedwing word om 'n enkele konformasie in kristalle te neem as gevolg van aan verpakkingsbeperkings. Boonop hou die tipiese metodes van voorspelling van sekondêre struktuur nie die invloed van tersiêre struktuur op die vorming van 'n sekondêre struktuur in ag nie, byvoorbeeld, 'n volgorde wat voorspel word as 'n waarskynlike heliks, kan nog steeds 'n beta-string-konformasie aanneem as dit in 'n beta geleë is -velde van die proteïen en sy sykettings pak goed by hul bure. Dramatiese veranderings in die konformasie wat verband hou met die funksie of omgewing van die proteïen kan ook die plaaslike sekondêre struktuur verander.

Historiese perspektief Redigeer

Tot op hede is meer as 20 verskillende voorspellingsmetodes vir sekondêre strukture ontwikkel. Een van die eerste algoritmes was die Chou-Fasman-metode, wat hoofsaaklik staatmaak op waarskynlikheidsparameters wat bepaal word uit relatiewe frekwensies van die voorkoms van elke aminosuur in elke tipe sekondêre struktuur. [11] Die oorspronklike Chou-Fasman-parameters, bepaal uit die klein steekproef van strukture wat in die middel-1970's opgelos is, lewer swak resultate in vergelyking met moderne metodes, alhoewel die parameterisering opgedateer is sedert dit die eerste keer gepubliseer is. Die Chou-Fasman metode is ongeveer 50-60% akkuraat in die voorspelling van sekondêre strukture. [1]

Die volgende noemenswaardige program was die GOR-metode is 'n inligtingsteorie-gebaseerde metode. Dit gebruik die kragtiger waarskynlikheidstegniek van Bayesiaanse afleiding. [12] Die GOR-metode neem nie net die waarskynlikheid dat elke aminosuur 'n spesifieke sekondêre struktuur het in ag nie, maar ook die voorwaardelike waarskynlikheid dat die aminosuur elke struktuur aanneem gegewe die bydraes van sy bure (dit neem nie aan dat die bure het dieselfde struktuur). Die benadering is sensitiewer en akkurater as dié van Chou en Fasman, omdat die strukturele neigings van aminosure slegs sterk is vir 'n klein aantal aminosure, soos prolien en glisien. Swak bydraes van elk van die vele bure kan 'n sterk effek in die algemeen oplewer. Die oorspronklike GOR -metode was ongeveer 65% akkuraat en is dramaties meer suksesvol in die voorspelling van alfa -helices as beta -velle, wat dit gereeld as lusse of ongeorganiseerde streke voorspel het. [1]

Nog 'n groot stap vorentoe was die gebruik van masjienleermetodes. Eerste kunsmatige neurale netwerkmetodes is gebruik. As opleidingsstelle gebruik hulle opgeloste strukture om algemene volgordemotiewe te identifiseer wat geassosieer word met spesifieke rangskikkings van sekondêre strukture. Hierdie metodes is meer as 70% akkuraat in hul voorspellings, hoewel beta-stringe steeds dikwels ondervoorspel word as gevolg van die gebrek aan driedimensionele strukturele inligting wat die moontlikheid van 'n beoordeling van waterstofbindingspatrone moontlik maak wat die vorming van die uitgebreide konformasie kan bevorder wat nodig is vir die teenwoordigheid van 'n volledige beta-blad. [1] PSIPRED en JPRED is enkele van die bekendste programme gebaseer op neurale netwerke vir proteïen sekondêre struktuurvoorspelling. Vervolgens het ondersteuningsvektormasjiene veral nuttig geblyk vir die voorspelling van die draaiplekke, wat moeilik is om met statistiese metodes te identifiseer. [13] [14]

Uitbreidings van masjienleertegnieke poog om meer fynkorrelige plaaslike eienskappe van proteïene te voorspel, soos ruggraatdihedrale hoeke in nie-toegewysde streke. Beide SVM's [15] en neurale netwerke [16] is op hierdie probleem toegepas. [13] Meer onlangs kan reële waarde wringhoeke akkuraat deur SPINE-X voorspel word en suksesvol aangewend word vir ab initio struktuur voorspelling. [17]

Ander verbeterings Wysig

Daar word gerapporteer dat bykomend tot die proteïenvolgorde, sekondêre struktuurvorming van ander faktore afhang. Daar word byvoorbeeld gerapporteer dat neigings van sekondêre strukture ook afhang van die plaaslike omgewing, [18] toeganklikheid van oplosmiddels van residue, [19] proteïenstruktuurklas, [20] en selfs die organisme waaruit die proteïene verkry word. [21] Op grond van sulke waarnemings het sommige studies getoon dat die voorspelling van die sekondêre struktuur verbeter kan word deur die toevoeging van inligting oor proteïenstruktuurklasse, [22] toeganklike oppervlaktes [23] [24] en ook kontaknommerinligting. [25]

Die praktiese rol van proteïenstruktuurvoorspelling is nou belangriker as ooit. [26] Groot hoeveelhede proteïenvolgordedata word geproduseer deur moderne grootskaalse DNS-volgordebepalingspogings soos die Menslike Genoomprojek.Ten spyte van gemeenskapswye pogings in strukturele genomika, bly die opbrengs van eksperimenteel bepaalde proteïenstrukture-tipies deur tydrowende en relatief duur röntgenkristallografie of NMR-spektroskopie-ver agter die uitset van proteïenvolgorde.

Die voorspelling van proteïenstruktuur bly 'n uiters moeilike en onopgeloste onderneming. Die twee belangrikste probleme is die berekening van proteïenvrye energie en die bepaling van die globale minimum van hierdie energie. 'N Proteïenstruktuurvoorspellingsmetode moet die ruimte ondersoek van moontlike proteïenstrukture wat astronomies groot is. Hierdie probleme kan gedeeltelik omseil word in "vergelykende" of homologie-modellering en vouherkenningsmetodes, waarin die soekruimte gesnoei word deur die aanname dat die betrokke proteïen 'n struktuur aanneem wat naby aan die eksperimenteel bepaalde struktuur van 'n ander homoloë proteïen is. Aan die ander kant moet die de novo proteïenstruktuurvoorspellingsmetodes hierdie probleme eksplisiet oplos. Die vordering en uitdagings in die voorspelling van proteïenstruktuur is deur Zhang hersien. [27]

Voor modellering Redigeer

Die meeste tersiêre struktuurmodelleringsmetodes, soos Rosetta, is geoptimaliseer vir die modellering van die tersiêre struktuur van enkel proteïen domeine. 'N Stap genoem domein ontleding, of domein grensvoorspelling, word gewoonlik eers gedoen om 'n proteïen in potensiële strukturele domeine te verdeel. Soos met die res van tersiêre struktuur voorspelling, kan dit vergelykend gedoen word vanaf bekende strukture [28] of ab initio slegs met die volgorde (gewoonlik deur masjienleer, bygestaan ​​deur kovariasie). [29] Die strukture vir individuele domeine word aan mekaar vasgemaak in 'n proses wat genoem word domein vergadering om die finale tersiêre struktuur te vorm. [30] [31]

In die begin proteïenmodellering Wysig

Energie- en fragmentgebaseerde metodes Wysig

In die begin- of De novo- proteïenmodelleringsmetodes poog om driedimensionele proteïenmodelle "van nuuts af" te bou, dit wil sê, gebaseer op fisiese beginsels eerder as (direk) op voorheen opgeloste strukture. Daar is baie moontlike prosedures wat óf probeer om proteïenvouing na te boots óf een of ander stogastiese metode toepas om moontlike oplossings te soek (d.w.s. globale optimalisering van 'n geskikte energiefunksie). Hierdie prosedures verg gewoonlik groot berekeningshulpbronne en is dus slegs vir klein proteïene uitgevoer. Om proteïenstruktuur te voorspel De novo vir groter proteïene sal beter algoritmes en groter berekeningshulpbronne benodig word soos dié wat deur óf kragtige superrekenaars (soos Blue Gene of MDGRAPE-3) óf verspreide rekenaars (soos [email protected], die Human Proteome Folding Project en [email protected]) voorsien word. Alhoewel hierdie berekeningshindernisse groot is, maak die potensiële voordele van strukturele genomika (volgens voorspelde of eksperimentele metodes) ab initio struktuurvoorspelling 'n aktiewe navorsingsveld. [27]

Vanaf 2009 kan 'n proteïen van 50 residue atoom-vir-atoom op 'n superrekenaar vir 1 millisekonde gesimuleer word. [32] Vanaf 2012 kan vergelykbare monsterneming in 'n stabiele toestand op 'n standaard lessenaar gedoen word met 'n nuwe grafiese kaart en meer gesofistikeerde algoritmes. [33] 'n Veel groter simulasietydskale kan bereik word deur gebruik te maak van growwe korrelmodellering. [34] [35]

Evolusionêre kovariasie om 3D -kontakte te voorspel Wysig

Namate volgordebepaling in die 1990's meer algemeen geword het, het verskeie groepe proteïenvolgordebelynings gebruik om gekorreleerde mutasies te voorspel en daar is gehoop dat hierdie saamgeëvolueerde residue gebruik kon word om tersiêre struktuur te voorspel (met behulp van die analogie tot afstandsbeperkings van eksperimentele prosedures soos KMR). Die aanname is dat wanneer enkele residumutasies effens nadelig is, kompenserende mutasies kan plaasvind om interaksies tussen residue en residue te herstel. Hierdie vroeë werk gebruik wat bekend staan ​​as plaaslik metodes om gekorreleerde mutasies vanaf proteïenvolgordes te bereken, maar het gely aan indirekte vals korrelasies wat voortspruit uit die behandeling van elke paar residue as onafhanklik van alle ander pare. [36] [37] [38]

In 2011, 'n ander, en hierdie keer wêreldwyd statistiese benadering, getoon dat voorspelde gesamentlike residue voldoende was om die 3D -vou van 'n proteïen te voorspel, mits daar genoeg rye beskikbaar is (en gt1,000 homoloë rye is nodig). [39] Die metode, EVfold, gebruik geen homologiese modellerings-, draad- of 3D -struktuurfragmente nie en kan op 'n standaard persoonlike rekenaar uitgevoer word, selfs vir proteïene met honderde residue. Die akkuraatheid van die kontakte wat met hierdie en verwante benaderings voorspel is, is nou gedemonstreer op baie bekende strukture en kontakkaarte, [40] [41] [42] insluitend die voorspelling van eksperimenteel onopgeloste transmembraanproteïene. [43]

Vergelykende proteïenmodellering Wysig

Vergelykende proteïenmodellering gebruik voorheen opgeloste strukture as beginpunte, of sjablone. Dit is effektief omdat dit blyk dat alhoewel die aantal werklike proteïene groot is, daar 'n beperkte stel tersiêre strukturele motiewe is waaraan die meeste proteïene behoort. Daar word voorgestel dat daar slegs ongeveer 2000 verskillende proteïenvoue in die natuur is, alhoewel daar baie miljoene verskillende proteïene is. Die vergelykende proteïenmodellering kan gekombineer word met die evolusionêre kovariasie in die struktuurvoorspelling. [44]

Hierdie metodes kan ook in twee groepe verdeel word: [27]

    is gebaseer op die redelike aanname dat twee homoloë proteïene baie soortgelyke strukture sal deel. Omdat 'n proteïen se vou meer evolusionêr behoue ​​bly as sy aminosuurvolgorde, kan 'n teikenvolgorde met redelike akkuraatheid gemodelleer word op 'n baie ver verwante sjabloon, mits die verband tussen teiken en sjabloon deur volgordebelyning onderskei kan word. Daar word voorgestel dat die primêre knelpunt in vergelykende modellering spruit uit probleme met belyning eerder as uit foute in struktuurvoorspelling, gegewe 'n bekende en goeie belyning. [45] Dit is nie verbasend dat homologiemodellering die akkuraatste is wanneer die teiken en sjabloon soortgelyke volgordes het. [46] skandeer die aminosuurvolgorde van 'n onbekende struktuur teen 'n databasis van opgeloste strukture. In elke geval word 'n puntefunksie gebruik om die verenigbaarheid van die ry met die struktuur te beoordeel en sodoende moontlike driedimensionele modelle te lewer. Hierdie tipe metode staan ​​ook bekend as 3D-1D vou herkenning as gevolg van sy verenigbaarheidsanalise tussen driedimensionele strukture en lineêre proteïenvolgorde. Hierdie metode het ook aanleiding gegee tot metodes wat 'n omgekeerde vou soek deur die verenigbaarheid van 'n gegewe struktuur met 'n groot databasis van rye te evalueer, en sodoende te voorspel watter rye die potensiaal het om 'n gegewe vou te produseer.

Modellering van syketting-konformasies Edit

Akkurate verpakking van die aminosuur -sykettings verteenwoordig 'n aparte probleem in die voorspelling van proteïenstruktuur. Metodes wat spesifiek die probleem van die voorspelling van sy-ketting meetkunde aanspreek, sluit in doodloopstraat eliminasie en die self-konsekwente gemiddelde veldmetodes. Die sykettingkonformasies met lae energie word gewoonlik bepaal op die rigiede polipeptied -ruggraat en met behulp van 'n stel diskrete sykettingkonformasies, bekend as "rotamers". Die metodes poog om die stel rotamers te identifiseer wat die totale energie van die model verminder.

Hierdie metodes gebruik rotamerbiblioteke, wat versamelings is van gunstige konformasies vir elke tipe residu in proteïene. Rotamer -biblioteke kan inligting bevat oor die konformasie, die frekwensie daarvan en die standaardafwykings oor gemiddelde tweedelige hoeke, wat gebruik kan word in monsterneming. [47] Rotamer-biblioteke word afgelei van strukturele bioinformatika of ander statistiese ontleding van syketting-konformasies in bekende eksperimentele strukture van proteïene, soos deur die waargenome konformasies vir tetraëdriese koolstofstowwe naby die verspringende (60°, 180°, -60°) saam te voeg. waardes.

Rotamer-biblioteke kan ruggraat-onafhanklik, sekondêr-struktuur-afhanklik of ruggraat-afhanklik wees. Ruggraat-onafhanklike rotamerbiblioteke verwys nie na ruggraatkonformasie nie, en word bereken uit alle beskikbare sykettings van 'n sekere tipe (byvoorbeeld, die eerste voorbeeld van 'n rotamer-biblioteek, gedoen deur Ponder en Richards by Yale in 1987). [48] ​​Sekondêre struktuurafhanklike biblioteke bied verskillende dihedrale hoeke en/of rotamerfrekwensies vir α < displaystyle alpha> -helix, β < displaystyle beta> -blad of spoel sekondêre strukture. [49] Ruggraat-afhanklike rotamerbiblioteke bied konformasies en/of frekwensies afhanklik van die plaaslike ruggraatkonformasie soos gedefinieer deur die ruggraat dihedrale hoeke ϕ en ψ , ongeag die sekondêre struktuur. [50]

Die moderne weergawes van hierdie biblioteke soos gebruik in die meeste sagteware word aangebied as multidimensionele verspreidings van waarskynlikheid of frekwensie, waar die pieke ooreenstem met die tweehoekige-hoekkonformasies wat as individuele rotamers in die lyste beskou word. Sommige weergawes is gebaseer op baie noukeurig saamgestelde data en word hoofsaaklik gebruik vir struktuurvalidering, [51], terwyl ander die relatiewe frekwensies in baie groter datastelle beklemtoon en die vorm is wat hoofsaaklik gebruik word vir struktuurvoorspelling, soos die Dunbrack rotamer biblioteke. [52]

Verpakkingsmetodes vir sykettings is die nuttigste vir die ontleding van die hidrofobiese kern van die proteïen, waar sykettings nouer verpak word, is dit moeiliker om die losser beperkings en groter buigsaamheid van oppervlakreste aan te spreek, wat dikwels meer rotamerkonformasies beslaan as net een. [53] [54]

In die geval van komplekse van twee of meer proteïene, waar die strukture van die proteïene bekend is of met 'n hoë akkuraatheid voorspel kan word, kan metodes van proteïen -proteïen -koppeling gebruik word om die struktuur van die kompleks te voorspel. Inligting oor die effek van mutasies op spesifieke terreine op die affiniteit van die kompleks help om die komplekse struktuur te verstaan ​​en om aanlegmetodes te lei.

'N Groot aantal sagtewaregereedskap vir die voorspelling van proteïenstrukture bestaan. Benaderings sluit in homologie-modellering, proteïendraad, ab initio metodes, sekondêre struktuurvoorspelling en transmembraan heliks en seinpeptiedvoorspelling. Sommige onlangse suksesvolle metodes wat gebaseer is op die CASP-eksperimente, is I-TASSER, HHpred en AlphaFold. Vir 'n volledige lys, sien die hoofartikel.

Evaluering van outomatiese struktuur voorspelling bedieners Wysig

CASP, wat staan ​​vir Critical Assessment of Techniques for Protein Structure Prediction, is 'n gemeenskapswye eksperiment vir proteïenstruktuurvoorspelling wat sedert 1994 elke twee jaar plaasvind. CASP bied die geleentheid om die kwaliteit van beskikbare menslike, nie-outomatiese metodologie te bepaal menslike kategorie) en outomatiese bedieners vir proteïenstruktuurvoorspelling (bedienerkategorie, bekendgestel in die CASP7). [55]

Die CAMEO3D Continuous Automated Model EvaluatiOn Server evalueer weekliks outomatiese proteïenstruktuurvoorspellingsbedieners met behulp van blinde voorspellings vir proteïenstrukture wat nuut vrygestel is. CAMEO publiseer die resultate op sy webwerf.


Metamorfe proteïene: die Janus -proteïene van strukturele biologie

Die strukturele paradigma wat die volgorde van 'n proteïen kodeer vir 'n unieke driedimensionele inheemse vou, erken nie die intrinsieke plastisiteit wat in konformasie-vrye energie-landskappe ingekap is nie. Metamorfe proteïene is 'n onlangs ontdekte klas biomolekules wat hierdie plastisiteit illustreer deur in te vou in ten minste twee afsonderlike inheemse toestandstrukture van vergelykbare stabiliteit in die afwesigheid van ligande of kofaktore om vou-omskakeling te vergemaklik. Die groeiende lys metamorfe proteïene toon duidelik dat hierdie proteïene nie blote afwykings in proteïen-evolusie is nie, maar eintlik 'n gevolg was van kenmerkende patrone in seleksiedruk soos dié wat in virus-gasheer ko-evolusie gevind word. In hierdie oorsig beskryf ons die struktuur-funksie-verhoudings wat waargeneem word in goed bestudeerde metamorfe proteïensisteme, met spesifieke fokus op hoe funksionele residue geskei of blootgestel word in die twee voue van die proteïen. Ons bespreek ook die implikasies van metamorfose vir die ontwikkeling van proteïene en die pogings wat aan die gang is om metamorfe stelsels slegs uit volgorde -eienskappe te voorspel.

1. Inleiding

Die enkel-volgorde-struktuur-funksie hipotese is die spil wat die wiele van strukturele biologie vir dekades laat draai het nadat die eerste kristalstruktuur van mioglobien in 1958 deur John Kendrew en kollegas opgelos is [1]. Hierdie hipotese bepaal dat die aminosuurvolgorde van 'n proteïen 'n unieke inheemse toestandstruktuur kodeer, wat dan 'n duidelike funksie verrig. In die afgelope twee dekades was daar 'n aantal ontdekkings wat hierdie hipotese uitgedaag het, tot die punt dat dit uitgedien is. Byvoorbeeld, ons weet nou van die bestaan ​​van intrinsiek versteurde proteïene [2–5], wat polipeptiedkettings is sonder stabiele sekondêre of tersiêre struktuur, maar wat nietemin lewensbelangrike funksies verrig deur 'n verskeidenheid meganismes soos vou by binding [6] of die verkryging van struktuur na post-vertalingswysigings [7]. Ons het gestroom op maanligproteïene [8,9] wat meer as een funksie kan verrig deur dieselfde polipeptiedvolgorde te gebruik. Ons verstaan ​​ook nou dat biomolekulêre funksie nie net bepaal word deur struktuur, soos oorspronklik vermoed nie, maar ook deur biomolekulêre dinamika wat op verskeie tydskale voorkom [10,11]. Uiteindelik het ons die opkoms van metamorfe proteïene gesien wat in meer as een unieke strukturele topologie kan vou [12]. In die antieke Romeinse mitologie was Janus die god van oorgange en dualiteit, begin en einde, oorlog en vrede, en aankoms en vertrek. Sy tweeledige natuur is vergestalt in sy uitbeelding as 'n god met twee koppe wat in teenoorgestelde rigtings wys. Gegewe hul vermoë om twee of meer verskillende inheemse strukture aan te neem, is metamorfe proteïene die Janus -proteïene van strukturele biologie.

Metamorfe proteïene bestaan ​​in twee of meer goed gedefinieerde strukture in die afwesigheid van ligande of kofaktore (figuur 1) [13–15]. Dit onderskei hulle van proteïene wat konformasionele herrangskikking ondergaan na bindingsgebeurtenisse. Alhoewel strukturele heterogeniteit 'n kenmerk van metamorfe proteïene is, beskou ons 'n proteïen nie as 'n metamorf nie, bloot omdat dit 'n heterogene ensemble aanneem. Byvoorbeeld, intrinsiek versteurde proteïene, wat vinnig tussen 'n aantal soortgelyke konformasies omskakel, kwalifiseer nie as metamorfe proteïene nie, omdat dit nie stabiele driedimensionele strukture het nie. Binne die raamwerk van hierdie definisie is daar egter aansienlike variasie in die kenmerke van die tans bekende metamorfiese proteïene. Byvoorbeeld, in die geval van lymfotaktien [16] en IscU [17], kan die twee strukture binne ongeveer 1 s omkeerbaar onderling omskakel en ook duidelike bindingsvennote binne die sel hê. In ander gevalle soos KaiB [18] en Mad2 [19], neem dit ure vir die twee konformasies om onderling om te skakel, en slegs een van die strukture het 'n stroomaf bindingskomponent. Metamorfiese proteïene illustreer die smeebaarheid inherent aan proteïenvrye energielandskappe en is handboekvoorbeelde waarom ons verby enkele statiese biomolekulêre strukture moet kyk as ons funksie en wanfunksionering in hul geheel wil verstaan.

Figuur 1. Verteenwoordigende konformasie vrye energie landskappe van 'n proteïen wat in 'n enkele struktuur vou (monomorf, a) en 'n metamorfe proteïen wat in twee verskillende strukture vou (b). Die monomorfe proteïen het in hierdie geval 'n enkele biologiese funksie, terwyl die metamorfe proteïen sy konformasionele heterogeniteit kan gebruik om meer as een biologiese funksie te verrig.

In hierdie oorsig beskryf ons eers die belangrikste kenmerke van vyf metamorfe proteïensisteme wat tot dusver struktureel gekenmerk is: lymphotactin, KaiB, IscU, Mad2 en RfaH. Ons fokus op die strukture van die twee konformasies en hoe 'n enkele volgorde twee inheemse state kan akkommodeer. Ons skets ook hoe die struktuur die funksie kan inlig. Hierdie stel metamorfe proteïene is nie volledig nie, en ander proteïene wat as metamorf beskryf is, sluit in selecase [20], MinE [21], CLIC [22] en HIV-1 reverse transkriptase [23]. Na aanleiding van hierdie beskrywing van vyf metamorfe proteïene, beskryf ons die opwindende verband tussen metamorfe proteïene en proteïenevolusie, asook die pogings wat aangewend is om metamorfe proteïene te voorspel deur slegs volgorde -inligting te gebruik. Ten slotte wys ons op die sinergistiese kombinasie van metodes wat ons huidige begrip van metamorfiese proteïene bevorder het.

2. Vou-omskakeling en die gevolge daarvan in belangrike metamorfe proteïensisteme

2.1. Limfotaktien

Een van die eerste proteïene wat as metamorf beskou word, was die menslike lymfaktaktien met 93 residu [16] (figuur 2) (Ltn, ook bekend as XCL1). Ltn is 'n lid van die XC-familie van chemokiene en is ongewoon omdat daar slegs een N-terminale Cys-oorblyfsel en slegs een intramolekulêre disulfiedbinding is, in teenstelling met lede van die CC-, CXC- en CX3C-families, wat vier hoogs bewaarde Cys en twee het disulfiedbindings elk [24,25].

Figuur 2. (a) Lymphotactin (Ltn) bestaan ​​in ewewig tussen 'n α + β chemokienvou (Ltn10, PDB ID: 1J8I) en 'n nuwe all-β dimere vou (Ltn40, PDB ID: 2JP1). (b) Die sekondêre strukturele elemente van die Ltn10- en Ltn40 -voue word as 'n funksie van die ry aangedui. (c) Die Ltn40 -dimeer -koppelvlak (onder) word gestabiliseer deur drie rye hidrofobiese residue (getoon in blou, rooi en groen sfere) wat loodreg op die monomeervlak loop. Hierdie residue is meestal oplosmiddel-blootgestel in Ltn10 (bo), terwyl die residue in die kern van Ltn10 (bv. Phe39, Val59 en Val60, getoon as geel stokke) oplosmiddel-blootgestel is in Ltn40. (d) (Bo) 1 H– 15 N heteronukleêre enkele kwantumkorrelasie (HSQC) spektra van Ltn by 10 ° C/200 mM NaCl (links), 37 ° C/150 mM NaCl (middel) en 40 ° C/geen sout (regs ), waar Ltn bestaan ​​as Ltn10, 'n mengsel van onderskeidelik Ltn10 en Ltn40 en Ltn40. Phe39 en Cys48 en Ala49 ruggraat resonansies wat voortspruit uit beide Ltn10 en Ltn40 kan in die middel spektrum gesien word wat die saambestaan ​​van die twee konformasies by hierdie temperatuur bevestig. (Onder) 15 N magnetisasie-uitruilspektrum van Ltn by 37 ° C/150 mM NaCl, wat kruispieke (swart) toon wat die Ltn10 (oranje) en Ltn40 (siaan) Trp55-syketting-NH-resonans verbind. Die teenwoordigheid van hierdie kruispieke demonstreer dat Ltn10 en Ltn40 inter-omskakel op die ms–s tydskaal. Paneel (d) word gewysig met toestemming van Tuinstra et al. [16].

Die vou-omskakeling van Ltn gaan gepaard met 'n dramatiese konformasionele herrangskikking van die kanonieke α + β chemokienvou (Ltn10) [26], waar Ltn as 'n monomeer bestaan, na die nuwe dimeriese al-β-vou (Ltn40) (figuur 2a,b) [16,27]. Die struktuur van Ltn10 bestaan ​​uit drie β-stringe, Ile24–Thr30, Ala36–Thr41 en Lys46–Asp50, sowel as 'n C-terminale α-heliks van Thr54–Lys66 en 'n 310 helix (Val21 – Arg23), terwyl die eerste 23 N-terminale residue en die C-terminale stert (Ser67-Gly93) wanordelik is. Tydens die transformasie na Ltn40 ontvou die α-heliks, terwyl 'n nuwe β-string by die N-terminus tussen residue 11–14 vorm, wat 'n vierstrengs Griekse sleutelvou tot gevolg het (figuur 2a,b). Feitlik alle inter-string waterstofbindings tussen β2-β3 en β3-β4 herorganiseer om die nuwe β1 te akkommodeer, wat 'n verskuiwing in die register van die β2-β3 en β3-β4 stringe veroorsaak [16]. Die dimeer-koppelvlak van Ltn40 word gestabiliseer deur drie imposante lae hidrofobiese residue (Val12, Ile38, Val47), (Leu14, Ile40, Leu45) en (Ile29, Ala36, Ala49) wat ortogonaal tot die monomeervlak gerangskik is, waarvan die meeste oplosmiddel- blootgestel in Ltn10 (figuur 2c). Daarteenoor bestaan ​​die hidrofobiese kern van Ltn10 uit residue Tyr27, Phe39, Val59 en Val60 wat uiteindelik in Ltn40 blootgestel word aan oplosmiddels. Hierdie inversie in die mate van oplosmiddelblootstelling van Ltn-reste gee die indruk dat die proteïen binne-buite gedraai is tydens vouwisseling.

Die chemokienvou word gevul by 10 ° C en 200 mM NaCl, terwyl die all-β-struktuur by 40 ° C verkies word by gebrek aan sout (figuur 2d). Interessant genoeg, onder fisiologiese toestande (37°C en 150 mM NaCl), is Ltn10 en Ltn40 ewe bevolk, en wissel vinnig en omkeerbaar tussen mekaar om met 'n tempokonstante van ongeveer 1 s-1. Daar word geglo dat die toename in ioniese sterkte die omskakeling van Ltn40 na Ltn10 bevoordeel deur 'n sleutelsoutbrug tussen Lys25 en Glu31 te breek wat die dimeriese toestand stabiliseer. Die uitruil tussen Ltn10 en Ltn40 is sigbaar in 15 N magnetisasie -oordrageksperimente (figuur 2d, onder) [16] en bevestig dat die twee vorme nie gevolge is van statiese heterogeniteit in die monster nie.

Ltn is 'n hoogs onwaarskynlike kandidaat vir 'n metamorfiese proteïen omdat dit 'n intramolekulêre disulfiedbinding tussen Cys11 en Cys48 het wat konformasievryheid beperk. Hierdie disulfiedkoppeling skep in werklikheid 'n sirkelvormige polipeptied wat oorblyfsels 11–47 strek, teen die agtergrond waarvan vouskakeling plaasvind. Die meganisme waarmee Ltn-vou-omskakeling plaasvind, is nog steeds 'n gebied van aktiewe navorsing. Die uitgebreide herbou van waterstofbindings en hidrofobiese interaksies wat tydens vouskakeling plaasvind, dui daarop dat 'n disulfiedgebonde 'ontvoude toestand' 'n intermediêre tussen die twee toestande moet wees. Fluetensie-gedetekteerde kinetiese metings van die gestopte-vloei-meting van die temperatuurafhanklikheid van ontvouing en inter-omskakeling toon baie soortgelyke waardes vir die entalpie en entropie van aktivering vir die twee prosesse, wat die idee bevestig dat inter-omskakeling deur 'n 'ontvoude toestand' moet voortgaan [28]. Die skrywers het ook ontvoutempokonstantes tussen 0.5 en 5 s -1 vir Ltn 40 en Ltn10 gemeet. Maar hoekom die ontvouende tempo konstantes is so vinnig wanneer ku waardes vir ander proteïene van soortgelyke grootte is oor die algemeen een – twee ordes van grootte kleiner [29], of selfs hoe die disulfiedgebonde 'ontvoude toestand' struktureel op die pad daar uitsien, bly onduidelik. In teenstelling met eksperimente, het inheemse-sentriese Go-modelle [30] sowel as replika-uitruil-simulasies [31] gesuggereer dat ontvouing nie nodig is vir vouskakel nie, en dat onderlinge omskakeling tussen Ltn10 en Ltn40 kan plaasvind via gedeeltelik ontvoude tussenprodukte wat verskil in die waterstofbindingspatrone van die β-vel.

Die Ltn10- en Ltn40 -toestande van lymfotaktien het verskillende biologiese funksies binne sy rol as chemokien, wat Ltn 'n werklik metamorfe proteïen maak [16,32]. Chemokiene word afgeskeide seinmolekules wat die migrasie van leukosiete reguleer as deel van die immuunrespons op inflammasie. Om hierdie doel te bereik, bind chemokiene nie net aan G-proteïengekoppelde reseptore (GPCR's) op die oppervlak van leukosiete en stimuleer migrasie nie, maar ook aan glikosaminoglikane (GAG's) om 'n konsentrasiegradiënt vir chemotaksis te vestig [24]. Struktuur-funksie korrelasies is egter uitdagend om in Ltn te vestig vanweë die naasbestaan ​​en omkeerbare omskakeling van die twee strukture. Met behulp van elegante proteïeningenieurswese benaderings, het Volkman en kollegas mutante gegenereer met een ekstra disulfiedbinding wat in die Ltn10 (V21C/V59C, CC3-Ltn) [33] of die Ltn40-konformasie (A36C/A49C, CC5-Ltn) [32] gesluit is ]. Alhoewel CC3-Ltn nie GAG's styf kan bind nie, is dit aan die ander kant 'n effektiewe agonis vir XCR1, maar CC5-Ltn bind GAG's met 'n hoë affiniteit.

Geplaas in die konteks van sy familielede, lyk die strukturele en funksionele kenmerke van Ltn verwarrend. Chemokiene dimereer gereeld terwyl hulle hul chemokienvou behou [25], maar Ltn skakel oor na 'n nuwe all-β-struktuur by homodimeervorming. Boonop bind chemokiene aan beide GAGs en GPCRs deur dieselfde chemokienvou te gebruik, maar die Ltn10-vorm van limfotaktien alleen het blykbaar die vermoë verloor om GAGs te bind, en die Ltn40-vorm is nie meer 'n funksionele agonis van XCR1 nie. Dit is onduidelik presies waarom lymphotactin so 'n metamorfe gedrag ontwikkel het om GAG -bindings- en GPCR -aktiveringsfunksies te skei in twee onderveranderende konformasies. Sommige leidrade het egter na vore gekom uit studies oor die rol van chemokiene as verdediging teen virusse, wat toon dat limfotaktien reg in die middel van 'n hewige en vinnig ontwikkelende slagveld tussen virusse en hul gashere is. Die genoom van die rat-sitomegalovirus het byvoorbeeld die vermoë ontwikkel om te kodeer vir 'n Ltn-agtige chemokien wat ook chemotaksie van rat-leukosiete kan veroorsaak [34,35]. Boonop is Ltn 'n breëspektrum-remmer van MIV-1 en blokkeer virale toetrede tot selle deur 'n meganisme wat die nuwe all-β-vou [36,37] vereis. 'n Positief gelaaide groep in die all-β-vou wat residue Lys42, Arg43, Arg18, Arg35 en Lys46 bevat, is nodig vir die binding van die MIV-1-omhulsel glikoproteïen gp120, wat die interessante moontlikheid verhoog dat metamorfe kenmerke in Ltn as verdediging in die arms ontwikkel het. wedloop teen virale infeksie.

2.2. KaiB

Die sianobakteriese KaiB-proteïen is die enigste metamorfiese proteïen wat tot dusver in sirkadiese ritmes geïdentifiseer is. Die sirkadiese ossillator in sianobakterieë bestaan ​​uit drie proteïene, KaiA, KaiB en KaiC, wat 24 uur ritmes in KaiC-fosforylering genereer deur hul tydsafhanklike interaksies met mekaar (figuur 3a) [38–40]. KaiC is 'n dubbelring-heksamer, wat bestaan ​​uit twee homoloë AAA+ ATPase-domeine, CI en CII [41]. Aan die begin van die dag is Thr432 en Ser431 van die CII-domein van KaiC ongewysig. Rond die middaguur word Thr432 in hierdie toestand gefosforyleer (S/pT), KaiA bind aan KaiC deur A-lusse wat teenwoordig is by die C-terminus van KaiC om outofosforylering te stimuleer [42]. Sodra Ser431 ook gefosforileer is (pS/pT), stapel die CI- en CII-ringe op mekaar om 'n bindingsplek vir KaiB (genoem die B-lus) op die KaiC CI-domein bloot te stel [43-45]. KaiB bind dan nie net aan KaiC nie, maar ook aan KaiA om 'n ternêre kompleks te vorm (figuur 3a), wat KaiA van KaiC sekwestreer en die defosforileringsarm van die sirkadiese ossillasie begin [46-48].

Figuur 3. (a) Die sianobakteriese sirkadiese siklus. KaiC (grys) is 'n tweedomein (CI en CII) proteïen wat in 'n heksamer georganiseer word. Fosforilering in die CII -domein van KaiC (getoon in aqua) by Thr432 en Ser431 help met die vasstelling van die 24 uur tydsperiode van die siklus. Teen die middag bind KaiA (oranje) aan A-lusse en stimuleer KaiC-outofosforilering. KaiB, wat bestaan ​​as 'n ewewig tussen die tetrameriese (groen), dimere (groen) en die monomere vou-omskakelde konformasies (pers), bind aan die B-lusse van die CI-domein van KaiC deur die tioredoksienagtige KaiBfs-vou, wat veroorsaak ontfosforilering in dieselfde volgorde teen skemer. Nadat beide Thr432 en Ser431 opeenvolgend gedefosforyleer is, herhaal die siklus. (b) In die grondtoestand is gratis KaiB 'n tetrameer van asimmetriese dimere (gekleur in geel en blou, PDB ID: 2QKE). (c) Die asimmetriese dimeer-koppelvlak word hoofsaaklik gestabiliseer deur hidrofobiese residue soos Ala15, Val47, Ile59 en Ile88 (getoon as sfere en groen en pienk gekleur). (d) Vouwisseling van KaiB lei tot die omskakeling van KaiBgs (monomeer wat aan die linkerkant gewys word, gekleurde reënboog) na KaiBfs (PDB ID: 5JYT, regs, dieselfde gekleur as KaiBgs), wat 'n tioredoksienvou aanneem. Terwyl die N-terminale segment van KaiB steeds die βαβ sekondêre struktuur in beide voue behou, herrangskik die C-terminale gebied van die βααβ in KaiBgs na αββα in KaiBfs. (e) Die kristalstruktuur van die funksionele KaiC (CI -domein) –KaiBfs -kompleks (PDB ID: 5JWO). Die CI-domein van KaiC is grys gekleur, terwyl die konstante gebied van KaiB in pienk getoon word en die vouskakelgebied in siaan. Die KaiC–KaiB-koppelvlak bestaan ​​hoofsaaklik uit die C-terminale streek van KaiB wat vouwisseling ondergaan. (f) Tydsverloop van binding van fluorescent gemerkte KaiB en sy variante met KaiC, gevolg deur fluorescentie-anisotropie. Thermosynechococcus elongatus (te) proteïene is in hierdie studie gebruik. S431E is 'n fosfomimetiese mutasie in KaiC wat binding aan KaiB fasiliteer. Die binding van wt KaiBgs is monofasies en vind plaas oor die tydskaal van 24 uur. Namate die fraksie van KaiBfs by ewewig deur mutasies verhoog word, word die binding bifasies. Die vinnige fase stem ooreen met die vinnige binding van bestaande KaiBfs aan KaiC, terwyl die stadige fase ooreenstem met die herrangskikking van KaiBgs na KaiBfs, gevolg deur binding. Hierdie eksperimente dui aan dat die vouwisseling van KaiB tempo-bepalend is in binding aan KaiC. Paneel (f) word weergegee met toestemming van Chang et al. [18].

In die vrye vorm (na verwys as die grondtoestand, gs), bestaan ​​KaiBgs as 'n tetrameer wat bestaan ​​uit twee asimmetriese dimere (figuur 3b, dimeer van dimere) [49]. Elkeen van die monomere in die tetrameer neem 'n nuwe vou aan wat bestaan ​​uit vier β-stringe en drie α-helices wat in die orde βαββααβ gerangskik is. β1 en β2 loop parallel met mekaar, terwyl β4 waterstofgebind en anti-parallel aan β1 is. β3 is 'n kort string wat 'n deel van die dimeer-koppelvlak vorm saam met die lus wat β2 en β3, die N-terminale segment van β4 en die C-terminale segment van β1 verbind. Die raakvlak is oorwegend hidrofobies van aard en bestaan ​​uit residue soos Ala15, Val47, Ile59 en Ile88 (figuur 3)c) die verwydering van residue 95–108 en terselfdertyd mutering van Tyr8 na Ala en Tyr94 na Ala in tetrameriese KaiB genereer 'n dimeer waar die monomere dieselfde KaiBgs -vou het. In sy metamorfe eweknie bestaan ​​KaiB as 'n monomeer wat in die tioredoksienvou georganiseer is met 'n βαβαββα sekondêre strukturele rangskikking (figuur 3)d) [18]. β1, α1 en β2 in die N-terminale helfte van KaiB verander nie beduidend in konformasie van die grondtoestand nie (paarsgewys wortelgemiddelde-kwadraatafwyking (RMSD) van Cα tussen die twee strukture van 1.3 Å), terwyl die C-terminale die helfte ondergaan aansienlike hermodellering tydens die vouwissel-geleentheid. Interessant genoeg lê die meeste grensvlakreste van die asimmetriese dimeer in die C-terminale gebied van KaiB, wat die grootste konformasionele veranderinge ondergaan by vouskakeling, wat daarop dui dat die asimmetriese KaiBgs-tetrameer uitmekaar moet val voordat vouskakeling kan plaasvind.

Die kristalstruktuur van KaiC (CI-domein) is kompleks met KaiB (figuur 3e) [50] onthul dat die koppelvlak tussen KaiBfs en KaiC bestaan ​​uit verskeie sleutelresidu soos Ala15, Val47, Ile59 en Leu60 wat in die asimmetriese dimeer-koppelvlak in KaiBgs gesekwestreer word. Hierdie residue word blootgestel in die tioredoksienagtige KaiBfs en is dus beskikbaar om KaiC te bind, wat weer die indruk gee dat die proteïen binne-in gedraai is. Die KaiB -metamorfe stelsel is nog 'n duidelike voorbeeld van hoe toeganklikheid vir oplosmiddels van funksionele residue gemoduleer word deur voordeel te trek uit die frustrasie wat in konformasie -vrye energie -landskappe gekodeer word om die funksie in verskillende konformasies van dieselfde proteïen te verander.

Baie min is bekend oor die meganisme van inter -omskakeling tussen KaiBfs en KaiBgs. Konformasie-herrangskikking tussen die twee state vind uiters stadig plaas en die verlengde wagtyd wat nodig is vir KaiBgs om na KaiBfs om te skakel, dra by tot die tydsvertraging wat nodig is vir die handhawing van die 24 uur sirkadiese tydperk [18]. Die kinetika van vouskakeling is slegs indirek geraam deur die binding van KaiB en sy variante aan KaiC te ondersoek. Dit is bekend dat slegs KaiBfs KaiC bind. Fluorescerend gemerkte wilde tipe KaiB bestaan ​​hoofsaaklik as KaiBgs (Keq(gs – fs) = 0,08) en die binding daarvan aan KaiC kan beskryf word deur 'n enkele kinetiese fase met 'n tydskonstante van ongeveer 12 uur [18]. Daarteenoor bestaan ​​G89A/D91R KaiB oorwegend as KaiBfs (Keq(gs – fs) = 6.7) en toon 'n burst -fase sowel as 'n stadige fase by die binding van KaiC. Die vinnige fase word geïnterpreteer as die assosiasie van KaiC met bindingsbevoegde KaiBfs-molekules teenwoordig by ewewig, terwyl die stadige fase ooreenstem met die onderlinge omskakeling van reeds bestaande KaiBgs na KaiBfs en die daaropvolgende binding aan KaiB. Aangesien die sarsiefase aansienlik vinniger is as die stadige fase, bied die benadering van die koersbepalende stap die KaiBgs-KaiBfs-omskakeling 'n skatting van die interkonversietempo-konstante in die orde van 12 uur. Drie bewaarde Xaa-Pro-skakelings, Thr62–Pro63, Leu69–Pro70 en Pro71–Pro72 skakel oor van 'n transkonformasie in KaiBgs na cis in KaiBfs, en hierdie verpligte isomerisering kan een van die redes wees waarom vouwisseling so stadig in KaiB is.

2.3. IscU

Escherichia coli IscU bied nog 'n variasie aan die tema van metamorfe proteïene, waar een van die konformers gestruktureer is en die ander gedeeltelik wanordelik is, maar albei verskillende funksies verrig. IscU is 'n lid van die ATP-afhanklike yster-swael cluster (Isc) biogenese pad wat werk in bakterieë en in mitochondria [17]. IscU is die steierproteïen waarop Fe–S-klusters saamgestel word voordat dit deur 'n gespesialiseerde Hsp70/Hsp40-stelsel na ontvanger-apoproteïene oorgedra word.

Die bestaan ​​van twee IscU -konformasies in termiese ewewig kan duidelik gesien word uit die 1 H– 15 N heteronukleêre enkele kwantumkorrelasie (HSQC) spektrum van IscU (figuur 4)a, links), wat twee stelle resonansies in stadige uitruiling op die KMR chemiese verskuiwing tydskaal vir verskeie residue vertoon, insluitend die syketting NH van die eensame Trp in IscU [51]. 15 N magnetisasie -uitruileksperimente toon onteenseglik aan dat die twee vorme omkeerbaar met koerskonstante omskakel kSD = 0.8 s −1 en kDS = 2.0 s -1 by 25°C (figuur 4a, onder) [52]. Die gestabiliteit van die gestruktureerde en wanordelike vorms is ongeveer gelyk aan 37 ° C (blS = 0.4, blD = 0.6, 150 mM NaCl, pH 8), terwyl IscU-S maksimaal stabiel is by 25°C [53]. Die gestruktureerde vorm van IscU (IscU-S) bestaan ​​uit 'n driestrengige β-vel by die N-terminus en 'n vier-heliks-bundel stroomaf wat op die β-vel dok (figuur 4)b) [54]. Drie van die vier helikse is kort (twee draaie), terwyl die C-terminale heliks lank is met sewe draaie. Die hidrofobiese kern van die proteïen word hoofsaaklik gevorm uit Ile-, Leu- en Val-residue met 'n paar interdigiterende Ala. Interessant genoeg is die ses aromatiese aminosure in IscU aansienlik blootgestel aan oplosmiddels en nie een van hulle neem deel aan die kern nie (figuur 4b, links) van IscU-S. Terwyl die NMR-spektrum van IscU-S goed versprei is, resoneer 'n groot fraksie van die pieke wat aan IscU-D behoort, by die ewekansige spoel chemiese verskuiwing, wat aandui dat IscU-D beide wanordelike en geordende streke het (figuur 4a, links). Hierdie waarneming word ondersteun deur 1 H– 15 N heteronukleêre kern -Overhauser -verbetering (NOE) waardes, wat negatief is vir die residue wat in die willekeurige spoelgebied val en andersins positief [53].

Figuur 4. (a) (Bo) 1 H– 15 N HSQC-spektra van IscU (links) wat gedupliseerde pieke toon vir die enigste Trp76-syketting (gestippelde boks) wat dui op die naasbestaan ​​van twee konformasies in die monster. Oorleggings van spektra (middel) van IscU in die teenwoordigheid van 3 mM Zn 2+ (rooi) of D39A IscU (groen) met apo wt IscU (swart) toon dat die geringe Trp-sykettingresonansie in beide gevalle verdwyn. Dit dui aan dat Zn 2+ en die D39A-mutasie dieselfde konformasie (IscU-S) stabiliseer. (Onder) 15 N magnetisasie-uitruilspektrum van apo wt IscU wat kruispieke (rooi) toon tussen die diagonale sykettingresonansies afkomstig van Trp76 in die twee saam bestaande konformasies van IscU. Die voorkoms van hierdie kruispieke toon aan dat IscU-S en IscU-D omkeerbaar omskakel op die ms-se tydskaal. (b) Spotprentvoorstelling van die KMR-struktuur van IscU-S (PDB ID: 2L4X). Die vier Pro-residue in IscU-S word as rooi stokkies getoon, terwyl die aromatiese residue magenta gekleur is. Vreemd genoeg word die meeste aromatiese residue blootgestel aan oplosmiddels en dra dit nie by tot die hidrofobiese kern van IscU-S nie. Die gestruktureerde IscU-S is in ewewig op ms-tydskaal met 'n gedeeltelik versteurde vorm, IscU-D. Twee van die Xaa-Pro-skakels in IscU-D, Asn13 – Pro14 en Pro100 – Pro101 is in cis-konformasie, terwyl al vier Xaa-Pro-bindings in IscU-S in die transvorm is. (c) Die rol van die steierproteïen IscU in die funksionele Fe–S-klusterbiogenesisiklus. (1) IscU bestaan ​​in twee konformasies, IscU-S en IscU-D. (2) Die piridoksaalfosfaat (PLP)-afhanklike ensiem IscS kataliseer die omskakeling van Cys na Ala en genereer op sy beurt persulfiede op IscU-D deur verkieslik daaraan te bind. Sodra Fe in hierdie kompleks ingebring is (3), vind vouwisseling plaas en die IscU-toestand word gestabiliseer deur die Fe–S-groepering. Die mede-begeleider van J-domein, HscB, herken IscU-S en vergemaklik die samestelling en oordrag van die Fe – S-groep na die stroomaf-aanneemproteïen (5-9). Tydens hierdie proses word IscU oorgedra na die Hsp70-agtige HscA, wat die gedeeltelik versteurde IscU-D-vorm van IscU stabiliseer. By vrystelling van HscA, word die vrye IscU dan weer in ekwilibreer in geordende en gedeeltelik ontvoude vorms om die siklus te herstel. Panele (a) en (c) word weergegee met toestemming van Markley et al. [17].

Afgesien van die orde-gedeeltelike wanorde-oorgang, is die mees prominente strukturele verandering wat plaasvind tydens die vou-omskakeling van IscU die verandering in die stereochemie van die Xaa-Pro-bindings van twee bewaarde Pro-residue Pro14 en Pro101 van trans (IscU-S) na cis (IscU-D) (figuur 4b) [53]. Aangesien Pro14 in die ongeordende N-terminus van IscU-S is, verstaan ​​ons nog nie die aard van interaksies wat dit stabiliseer in die cis-vorm in IscU-D nie.Dit is moontlik dat die cis Asn13-Pro14-binding die N-terminus nader aan die res van die proteïen bring en hidrofobiese oppervlakarea begrawe om die cis Pro14-konformasie te stabiliseer. Anders as in KaiB, waar Pro cis-trans-isomerisasie van drie Xaa-Pro-bindings waarskynlik vouwisseling na die tydskaal van ure vertraag, vind die isomerisering van twee sulke bindings in IscU binne 'n sekonde plaas. Aangesien die snelheidskonstante van 'n enkele Pro cis-trans-isomerisering tipies 1-2 orde van grootte stadiger in modelpeptiede [55] voorkom as in IscU, bly die rede vir hierdie versnelling in IscU onduidelik.

Die twee metamorfiese toestande van IscU het verskillende funksies net soos in die geval van limfotaktien (figuur 4)c). IscU-D bind selektief aan die cysteine ​​desulfurase [52], IscS, wat 'n piridoksale fosfaatafhanklike ensiem is wat 'n swael genereer en na Cys-residue in IscU vorm om persulfiede te vorm. Die daaropvolgende vorming van die Fe – S-groep veroorsaak vou-omskakeling deur die geordende vorm van IscU te stabiliseer, wat van IscS na HscB (DnaJ-agtige Hsp40) migreer in dieselfde konformasie. IscU bly in die gestruktureerde toestand totdat die Fe–S-kluster na die aanvaarderproteïen oorgedra word en IscU-S via HscB na HscA/ATP teruggeplaas word. Die gestruktureerde steier is nodig om die ontluikende Fe – S -groep te stabiliseer voordat dit na die apoproteïen oorgeplaas word [17]. Aan die ander kant, aangesien HscA (DnaK-agtige Hsp70) wanordelike en gedeeltelik geordende spesies bind, skakel IscU voue van IscU-S na IscU-D en word dit weer vrygestel in die Fe-S biogenese-pad in die wanordelike konformasie. Dus, terwyl IscU-S IscS en HscB bind op grond van sy struktuur, is IscU in wisselwerking met HscA in die gedeeltelik geordende IscU-D vorm as gevolg van die beperkings wat deur die bindende sak van HscA opgelê word, wat 'n funksionele konteks vir die metamorfiese gedrag verskaf.

2.4. Mal 2

Die metamorfose van Mad2 speel 'n integrale rol in die vestiging van die proteïen-proteïen-interaksies wat deel vorm van die selsiklus-toesigmeganisme genoem die spilkontrolepuntkompleks [56,57]. Tydens mitotiese seldeling vind die belyning van chromosome by die metafaseplaat plaas deur die aanhegting van die kinetochoor in elke susterchromatied aan mikrotubules wat afkomstig is van teenoorgestelde spilpale. Onvolledige aanhegting van susterchromatiede aan die mitotiese spil tydens metafase kan aneuploïdie in die dogterselle tot gevolg hê en dit word voorkom deur die kontrolepunt van die spil (SAC). Die oorgang van metafase na anafase word bemiddel deur die anafase-bevorderende kompleks APC/C, wat 'n ubiquitin ligase is wat sekurien en siklin B. polyubiquitineer. Op sy beurt aktiveer onaangehegte kinetochore by die metafaseplaat SAC, wat APC/C inhibeer en die aanvang van anafase vertraag.

Die eerste metamorfe proteïen wat ontdek is, die 25 kDa Mad2, is waarskynlik 'n sentrale komponent van die SAC wat in 'n HORMA -domein vou (vernoem na die Hop1p, Rev7 en Mad2 proteïene) [58]. Die kernstruktuur van Mad2 het drie α-helices en 'n β-haarspeld tussen helices A en B, sowel as 'n drie-strandige anti-parallelle β-vel (figuur 5a). Hierdie kern word behou tydens die metamorfe oorgang tussen C-Mad2 [59] en O-Mad2 [60], waartydens 'n tweede β-haarspeld van die een kant van die β-vel na die ander beweeg. Hierdie C-terminale β-haarspeld, bestaande uit stringe 7 en 8, waterstofbindings met string 6 in O-Mad2 (figuur 5)a, links), terwyl die N-terminus van die proteïen 'n kort β-string vorm wat in lyn is met string 5. By konformasionele inter-omskakeling verplaas die C-terminale haarspeld (gemerk as stringe 8 ′ en 8 ″) die N-terminale β- string tot waterstofbinding met string 5, terwyl die N-terminale β-string herrangskik in twee ekstra draaie van helix A (figuur 5a, regs). Daar is dus 'n dramatiese verandering in die waterstofbindingsnetwerk in die periferie van die proteïen, soortgelyk aan wat in Ltn waargeneem word.

Figuur 5. (a) Ortogonale aansigte (bo en onder) van die spotprentvoorstelling van O-Mad2 (links, PDB ID: 1DUJ), I-Mad2 (middel, PDB ID: 3GMH) en C-Mad2 (regs, PDB ID: 1S2H). Die N-terminale en C-terminale gebiede wat vouskakel ondergaan, word onderskeidelik in blou en groen getoon, terwyl die kern wat onveranderd bly, in liggeel aangedui word. Stringe en heliks word onderskeidelik aangedui met syfers en hoofletters. Die onderste aansig toon dat die heliks-oriëntasie van I-Mad2 lyk soos die van C-Mad2, alhoewel die algehele vou dieselfde is as dié van O-Mad2. (b) Die funksionele siklus van Mad2 binne die spilkontrolepuntkompleks. Gratis de novo-gesintetiseerde Mad2 bestaan ​​hoofsaaklik as O-Mad2, terwyl die C-Mad2 in selle bestaan ​​as 'n nou kompleks met Mad1. Die Mad1–C-Mad2-kompleks word gewerf na onaangehegte kinetochore en die C-Mad2 vorm 'n asimmetriese homodimeer met O-Mad2. Hierdie C-Mad2–O-Mad2 interaksie skakel O-Mad2 na I-Mad2 om en aktiveer dit daarna om die verwante bindingsvennoot, Cdc20, te herken. Sekwestrasie van Cdc20 inhibeer die APC/C ubiquitin-ligase en voorkom die voortydige skeiding van susterchromatiede.

Alhoewel 'n groot deel van die strukturele basis vir vouing en onderomskakeling in die Mad2 -metamorfose onderlig moet bly, het 'n blik op die kompleksiteit in die vouproses begin verskyn. Net soos KaiB vind die O-Mad2 – C-Mad2 herrangskikking baie stadig plaas, op 'n tydsbestek van 'n paar uur, met die voorwaartse reaksie 9 uur en die terugwaartse reaksie 6 keer langer [59]! C-Mad2 is ongeveer 10-voudiger stabieler as O-Mad2 [59], alhoewel die presiese getal wissel na gelang van die bron en dit moeilik was om vas te stel deels as gevolg van die onomkeerbaarheid in termiese denaturasie-eksperimente, en deels as gevolg van die lang tye nodig vir die O-Mad2 – C-Mad2-arm om ewewig te bereik [61]. In skerp kontras met die stadige interomsettingkinetika, het fluoressensie-bespeurde gestopte-vloeimetings getoon dat die vou en ontvouing van O-Mad2 en C-Mad2 op 'n tydskaal van sekondes plaasvind (kf(C-Mad2) = 11 s −1, kf(O-Mad2) = 6 s −1 , ku(C-Mad2) = 0,046 s −1 , ku(O-Mad2) = 0,086 s −1 ) [61]. Hierdie eksperimente ondersteun die idee dat interomskakeling tussen O- en C-Mad2 plaasvind via plaaslike of globale ontvouing na 'n hoë-energie-konformasie, gevolg deur kinetiese verdeling en hervou na óf die O- óf die C-Mad2-vorms [62].

Mad2 is 'n voorbeeld van die gesofistikeerdheid wat waargeneem kan word in die proteïenvou -kinetika, termodinamika en paaie, en hoe selle hierdie kompleksiteite kan gebruik. Een van die mees fassinerende vrae oor metamorfe proteïene is byvoorbeeld die triage tussen die alternatiewe proteïenkonformasies wat met de novo proteïenvou gepaard gaan. Feitlik al die vrye Mad2 binne-selle is teenwoordig as kineties vasgevang inaktiewe O-Mad2 wat ontstaan ​​as gevolg van de novo proteïenvouing en nie in staat is om na C-Mad2 om te skakel nie weens die stadige onderlinge omskakeling tussen die twee vorme [19,59]. Daarom blyk dit dat die C-Mad2/O-Mad2-stelsel binne-in selle in 'n nie-ewewigstoestand bestaan ​​(figuur 5)b). Daarenteen word sellulêre C-Mad2 styf aan Mad1 by kinetochore gevind tydens kontrolepuntaktivering en fluoressensieherstel nadat fotobleiking (FRAP) data getoon het dat daar min of geen omset van hierdie kompleks is nie [63-66]. Aangesien die stroomaf-teiken van Mad2, Cdc20, op dieselfde plek as die stroomop-aktivator, Mad1 [67,68] bind, staan ​​modelle wat die erkenning van Cdc20 deur Mad2 beskryf, voor 'n raaisel: enersyds het die Cdc20-bindingsbevoegde konformasie lyk soos C-Mad2, en alle C-Mad2-molekules word gesekwestreer deur Mad1 aan die ander kant, al die gratis Mad2 is vasgevang in die onaktiewe O-Mad2-konformasie wat nie omskakel na C-Mad2 op die tydskaal van kontrolepuntaktivering nie. Elegante werk van verskeie laboratoriums het getoon dat hierdie probleem opgelos word deur die vermoë van die Mad1-C-Mad2-kompleks om die omskakeling van latente O-Mad2 na C-Mad2 te kataliseer en sodoende Mad2 te aktiveer om Cdc20 [60,66,68– te bind] 73]. Onlangs is die strukturele kenmerke van 'n intermediêre C-Mad2–I-Mad2-kompleks opgelos met behulp van 'n kombinasie van X-straalkristallografie en KMR-spektroskopie [74] wat onthul hoe I-Mad2 die O-Mad2-vou behou, maar 'n kern en helix-bundel-oriëntasie wat soos C-Mad2 lyk (figuur 5a, middel), wat die interessante moontlikheid verhoog dat I-Mad2 'n intermediêre tussenpad kan wees wat O- en C-Mad2 verbind.

Post-translasionele modifikasies binne die sellulêre omgewing bied 'n ander manier om konformasie-ewewig in metamorfe proteïene te moduleer, soos gesien in die geval van Mad2. Fosforilering van Mad2 by Ser195, sowel as die fosfomimetiese mutasie S195D, rem die konformasie-oorgang van O-Mad2 na C-Mad2, soos waargeneem uit tydsafhanklike 1D NMR spektra van die wt proteïen en sy variante [75]. Die funksionele gevolg van hierdie inhibisie is dat S195D Mad2 nie sy verwante ligand Cdc20 bind nie, en die uitdrukking van hierdie variant binne selle lei tot tekortkominge in spilkontrolepuntregulering.

2.5. RfaH

Die E coli virulensiefaktor RfaH is 'n handboekvoorbeeld van hoe interdomeininteraksies proteïenkonformasie kan moduleer (figuur 6a,b). RfaH is 'n paralog van NusG en beide proteïene het struktureel soortgelyke N-terminale domeine (NTD's) wat aan RNA-polimerase (RNAP) bind en dit oorskakel na 'n pouse-weerstandige prosessiewe modus [76,77]. Die C-terminale domein (CTD) van NusG is 'n β-vat wat onafhanklik van die NTD bly en in wisselwerking is met die transkripsieterminasiefaktor Rho [78-80]. In teenstelling hiermee is die CTD van vrye RfaH (RfaHC) vou in 'n α-heliese haarnaald (figuur 6a) wat aan die NTD bind en die RNAP -herkenningsmotief sekwestreer (figuur 6c) [81]. As RfaH DNA bind, distansieer die NTD en CTD van mekaar, wat die NTD in staat stel om met RNAP [81,82] te assosieer. Terselfdertyd herrangskik die CTD spontaan van 'n α-heliese haarnaald in 'n vyfstrengs β-vat (figuur 6b) wat baie ooreenstem met die CTD van NusG [83]. Die opgeknapte CTD van RfaH reageer dan met die ribosoom om translasie te aktiveer (figuur 6d), wat 'n brug genereer wat transkripsie en vertaling koppel. Die vouwisseling wat plaasvind wanneer RfaHC dissosieer van die NTD toon die belangrikheid van interdomein interaksies in die stabilisering van die α-heliese vou van die CTD [82].

Figuur 6. (a) Tekenprentvoorstelling van die X-straalstruktuur van RfaH in volle lengte (PDB ID: 2OUG). Die N-terminale domein (NTD) word in grys getoon, terwyl die vouwisselende C-terminale domein (CTD) gekleurde reënboog is. In gratis RfaH in volle lengte is die CTD spiraalvormig. (b) Die all-β-velstruktuur van die CTD van RfaH verkry met behulp van NMR-spektroskopie (PDB ID: 2LCL). Die kleurskema is identies aan die CTD in (a). (c) Die residue in die NTD (ligpienk) wat belangrik is vir die binding van RNA -polimerase, word as stokke op die struktuur van RfaH getoon en geel gekleur. Die meeste van hierdie residue word geskei deur die heliese CTD (siaan) in die vrye vorm van RfaH, maar word blootgestel by vouskakel en losmaak van die CTD uit die NTD. (d) Die oorblyfsels in die CTD (siaan) wat belangrik is vir die binding van die ribosomale proteïen S10 word as groen sfere in beide die spiraalvormige (boonste) en velvorme van die CTD getoon. Die meeste van hierdie oorblyfsels word ook by die NTD-CTD-koppelvlak begrawe, maar word beskikbaar vir binding van S10 wanneer die NTD met RNA-polimerase in wisselwerking tree.

Die RfaH-stelsel bied nog 'n variasie aan die tema van metamorfiese proteïene aangesien dit 'n multidomeinproteïen behels waar een van die domeine as 'n steier vir die metamorfose van die ander domein optree [83]. Soortgelyk aan Ltn, is daar 'n wêreldwye konformasieverandering in RfaHC aangesien dit oorskakel van die outo-inhiberende α-heliese konformasie na die funksioneel aktiewe β-velvorm. Die β-velkonformasie bevat vyf β-stringe wat in die volgorde β5(F158–K160)–β1(K115–I118)–β2(Q127–F130)–β3(R138–N144)–β4(E149–K155) gerangskik is. RfaHC bestaan ​​op sigself in die β-blad-konformasie. Om aan te toon dat vou-omskakeling ook plaasvind in die konteks van vollengte RfaH, het Rösch en kollegas 'n variant E47S geskep, waarin 'n belangrike elektrostatiese skakel tussen Glu47 en Arg138 wat die NTD en CTD verbind, onderbreek word [83]. Pieke wat voortspruit uit beide die α-heliese en β-vel konformasies met 'n intensiteitsverhouding van ongeveer 1: 1 kan gesien word in die 1 H– 15 N HSQC spektrum van E47S RfaH, wat toon dat die spiraalvormige en velstrukture saam kan bestaan.

Terwyl eksperimentele studies wat die interomskakeling van die heliese en plaatvorme van RfaH ondersoek, ontbreek, is daar 'n aantal rekenaarstudies wat hierdie vraag aanspreek deur gebruik te maak van metodes soos geteikende molekulêre dinamika [84], Markov-toestandsmodellering [85], replika-uitruiling [86- 88] en kwasi-kontinue interpolasie [89], growwe korrel simulasies [90], dubbel-bekken struktuur-gebaseerde modelle [91] en trek simulasies [92]. Daar is algemene ooreenstemming dat interomsetting veroorsaak word deur die uitrafeling van die N-terminale α-heliks. Sommige studies het voorgestel dat daaropvolgende hermodellering plaasvind deur 'n hoë-energie-ensemble van wanordelike konformasies [85-87,89] wat mettertyd die vyfstrengige β-vel vorm deur 'n reeks toestande met een of meer β-haarnaaldjies. Die growwe struktuur-gebaseerde model voorspel egter dat daar twee op-pad-tussenprodukte is wat die vouwisseling vergemaklik, met een van hulle wat na die heliese lyk en die ander, die plaatkonformasies [91].

3. Evolusionêre belangrikheid van metamorfiese proteïensisteme

Die studie van metamorfe proteïene is nie net relevant nie, omdat hierdie proteïene gebruik maak van komplekse konformasie -vrye energie -landskappe vir funksie, maar ook vanweë die insigte wat hulle beloof om proteïene evolusie te bied. Vanuit hierdie evolusionêre oogstuk is metamorfiese proteïene op drie maniere betekenisvol. Eerstens lewer metamorfe proteïene bewyse op molekulêre vlak vir die ontsnapping uit adaptiewe konflik (EAC) [93] model van proteïen evolusie [94–96]. Adaptiewe konflik is 'n fundamentele raaisel in molekulêre evolusie wat die moeilikheid van 'n proteïen beskryf om aan te pas by 'n nuwe funksie, terwyl dit steeds sy voorvaderlike funksie behou. In modelle soos neofunksionalisering vind aanpassing plaas na 'n geen -duplikasiegebeurtenis, met een genkopie wat die voorvaderlike funksie behou en die tweede kopie ontwikkel om die nuwe funksie uit te voer [97]. Aan die ander kant is EAC 'n model waar multifunksionele (of maanlig) proteïene aanpasbare prosesse vergemaklik, beide voor en na geen duplisering [98]. Met die ontdekking van metamorfe proteïene, weet ons nou dat proteïene struktureel afsonderlike maar omkeerbare voue kan aanneem wat direk tot multifunksionaliteit lei. So 'n konformasionele heterogeniteit kan proteïen evolusie moontlik maak deur die funksionele repertorium van 'n beperkte stel proteïenvolgorde uit te brei [99–103].

Tweedens, metamorfiese proteïene is brûe tussen twee afsonderlike proteïenvoue en verteenwoordig intermediêre toestande in mutasiepaaie wat die twee strukturele topologieë verbind. In hierdie konteks word hulle uniek geplaas as modelstelsels vir berekenings [104] en eksperimentele [105] studies van meganismes onderliggend aan evolusionêre dinamika, die rol van seleksiedruk en die impak van mutasies.

Ten slotte, hoe metamorfe proteïene ontwikkel het en hoe hul voorouers gelyk het, is op sigself 'n fassinerende vraag. In 'n elegante onlangse studie [106] het Volkman en medewerkers sommige van hierdie vrae aangespreek deur filogenetiese voorvaderlike rekonstruksiemetodes te gebruik om reekse van voorouers van Ltn te genereer en hulle te karakteriseer deur gebruik te maak van KMR-spektroskopie. Ltn het ontwikkel van 'n voorouer wat die chemokienvou gehad het. Die verlies aan die tweede behoue ​​disulfiedkoppeling wat in chemokiene voorkom, was een van die vroegste gebeurtenisse in die evolusie daarvan, hoewel dit nie voldoende was vir die ontstaan ​​van metamorfose nie. Daaropvolgende voorouers was metamorfies, maar die simmetriese bevolking van die twee voue was een van die laaste gebeure wat in Ltn-evolusie plaasgevind het. Een van die treffendste gevolgtrekkings oor hierdie verslag is dat Ltn nie 'n evolusionêre intermediêre oorgang van die chemokienvou na die nuwe dimeriese Ltn40-vou blyk te wees nie, maar eerder blykbaar ontwikkel het om metamorfies te bly. Dit dui daarop dat metamorfe proteïene nie noodwendig skakels in proteïen -evolusie hoef te ontbreek nie, maar ook eindpunte in evolusie kan verteenwoordig.

4. Voorspelling gebaseer op metamorfiese proteïene

Die uitdagings wat inherent is aan die sistematies identifisering van metamorfiese proteïene met behulp van eksperimentele benaderings, in teenstelling met hul serendipite ontdekking, het die intrige vraag laat ontstaan ​​of metamorfose voorspel kan word op grond van proteïenvolgorde alleen. Alhoewel hierdie vraag moeilik is om aan te spreek omdat daar baie min werklik metamorfe proteïenvolgorde beskikbaar is, is daar twee verskillende benaderings aangeneem om sulke berekeningsalgoritmes te ontwikkel.

Die eerste benadering gebruik 'n biofisiese hidrofobiese-polêre model om die proteïenvolgorde te grofkorrel [104]. Proteïenreekse word behandel as stringe van 18 krale wat hidrofobies of polêr kan wees. Die konformasie van hierdie string word beskryf as 'n selfvermydende wandeling op 'n tweedimensionele roosterrooster. Elke intrakettingkontak tussen pare hidrofobiese krale word 'n gunstige energie toegeken wat dien om die vou van hierdie tou aan te dryf. Die geboortestaat -agteruitgang van 'n ry word dan gedefinieer as die aantal inheemse state wat dieselfde aantal hidrofobiese kontakte het. Binne hierdie definisie word rye met 'n degenerasiewaarde groter as 1 as metamorfies (of bi-stabiel) geklassifiseer. Met behulp van hierdie definisie het Chan en kollegas [104] 181 tweestabiele proteïene geïdentifiseer in die proteïenkonformasiedatabasis [107], 'n versameling proteïene uit die PDB waarvoor meer as een struktuur gerapporteer is. 'N Interessante kandidaat onder hierdie voorspelde stel is spinasiechloroplast tioredoksien (PDB ID: 1FB6 [108], 1GL8 [109]), waar die N-terminale segment van die tweede α-helix in 1FB6 in twee gebuig is 310 helikse in 1GL8 wat teen ongeveer 110° en 90° na die C-terminale helfte van die heliks georiënteer is. Dit is reeds bekend dat die tioredoksienvouing betrokke is by die metamorfose van KaiB [18], alhoewel die eerste heliks in KaiB onveranderd bly in ooreenstemming in die twee voue van KaiB. Daarteenoor is hierdie heliks anders gestruktureer in die voorspelde metamorfose van spinasie -thioredoksien, wat daarop dui dat die ou tioredoksienvou meer as een metamorfe oorgang tydens evolusie ondergaan het.

Die tweede klas benaderings is gebaseer op die veronderstelling dat metamorfe proteïene sekondêre struktuurvoorspellingsalgoritmes moet verwar [110–112].Die uitset van volgorde-gebaseerde sekondêre struktuurvoorspellingsalgoritmes sal na verwagting dubbelsinnig wees vir streke van metamorfe proteïene wat konformasie in die twee voue verander, en hierdie dubbelsinnigheid is aangewend om proteïenmetamorfose te voorspel. Porter en Looger [110] het teenstrydige sekondêre struktuurvoorspellings gebruik, tesame met die bestaan ​​van onafhanklike vou-eenhede binne proteïene (geïdentifiseer met behulp van die struktuurenergie-ekwivalensie van domeine (SEED) -algoritme) om ongeveer 100 vouskakelende proteïene wat in die PDB geregistreer is, op te spoor , asook nog ongeveer 100 proteïene wat net een opgeloste struktuur het, maar wat tog voorspel word om voue te verander. Net so het Wang en kollegas [112] 'n model saamgestel wat opgelei is op 201 metamorfe en 136 monomorfe proteïenstrukture uit die PDB, en hierdie model klassifiseer proteïene as monomorf of metamorfies gebaseer op die ry. Daar moet op gelet word dat beide hierdie studies alle vouskakelende proteïene as metamorf beskryf, terwyl die metamorfe proteïene wat in hierdie artikel beskryf word, in veelvoudige gevoude toestande bestaan ​​in die afwesigheid van ligande of kofaktore. Alhoewel die vals positiewe koers vir sekwensgebaseerde voorspelling van metamorfe proteïene hoog bly (10-30%), verteenwoordig hierdie algoritmes belangrike eerste stappe om hierdie uitdagende probleem die hoof te bied. Die interessante kandidate wat uit hierdie tweede benadering te voorskyn kom, is 'n aantal virale proteïene, soos bakteriofaag T7 en SARS-glikoproteïene, sowel as porie-vormende gifstowwe wat in die membrane kom, alhoewel daar nog geen eksperimentele validering van hierdie voorspellings is nie.

5. Metodes om metamorfiese proteïene te bestudeer

Die saambestaan ​​van veelvuldige konformasies in ewewig het 'n beduidende uitdaging in die opsporing en karakterisering van metamorfiese proteïene gestel. Kristallografiese en NMR -struktuurbepalingspypleidings word oor die algemeen geoptimaliseer om sulke heterogene stelsels uit te wis, en hierdie implisiete vooroordeel in monstervoorbereiding kan die oorsaak wees waarom die lys metamorfiese proteïene so kort bly. Sedert die bestaan ​​van proteïene met veelvoude gevoude konformasies vasgestel is, het 'n aantal eksperimentele en berekeningshulpmiddels egter saamgekom om ons begrip van metamorfe proteïensisteme te bevorder. Die hoofvrae wat aangespreek is, sluit in die strukture van die twee konformasies, die meganisme van interomskakeling, die ondersoek na die funksies van die verskillende konformers, en 'n paar tergende kyke na die evolusie van metamorfe proteïene.

Beide röntgenkristallografie en NMR-spektroskopie is bewys dat dit ewe belangrik is om die strukture van metamorfe proteïene wat in 'n bepaalde konformasie vasgevang is, toe te lig. Terwyl die strukture van Ltn10 [26], Ltn40 [16], KaiBfs [18], O-Mad2 [60], C-Mad2 [59], IscU-S [51], IscU-D [52] en RfaH (almal) -β) [83] is opgelos met behulp van KMR-spektroskopie, die strukture van KaiBgs [49] en RfaH (all-α) [81] is met behulp van X-straalkristallografie bepaal. Die strukturele kenmerke in hierdie stelsels is ook geïdentifiseer en gevalideer met behulp van komplementêre metodes soos massaspektrometrie [113–115]. Multidimensionele NMR -spektroskopie was op die voorpunt van navorsing op hierdie gebied vanweë sy vermoë om atoomresolusie -inligting te verskaf oor stelsels wat statiese en dinamiese heterogeniteit vertoon [116-118]. KMR was deurslaggewend in die vasstelling van die teenwoordigheid van veelvuldige konformasies in al die metamorfiese proteïene wat in hierdie oorsig beskryf word, sowel as om die omkeerbare interomsetting van hierdie konformasies in Ltn en IscU onomwonde te demonstreer. Verder verwag ons dat die nuut ontwikkelde KMR-metodologie vir die strukturele karakterisering van yl en verbygaande bevolkte biomolekulêre konformasies [10], soos chemiese uitruilversadiging-oordrag [119,120] en ontspanningsverspreiding [121,122], sal help om ons begrip van die meganismes onderliggend aan konformasie-interomskakeling te bevorder. in hierdie stelsels.

Meganistiese studies wat die atoombesonderhede van vouwisseling ondersoek, het tot dusver hoofsaaklik binne die domein van berekeningsmetodes gebly. Die klein (ongeveer 100 residu) grootte van baie van hierdie proteïene maak hulle vatbaar vir gesofistikeerde molekulêre dinamika-metodes sonder om 'n swaar las op rekenaarhulpbronne te plaas. Grofkorrelige sowel as all-atoom molekulêre dinamika (MD) simulasies was nuttig om die vrye energie landskap en kinetiese weë van Ltn [114], Mad2 [123] en RfaH (sien hierbo) in kaart te bring. Die teenstrydige voorspellings van berekeningsmetodes in die geval van RfaH het dit egter duidelik gemaak dat sulke meganistiese studies baat sal vind by eksperimentele metings. Dit is verbasend dat enkelmolekule-metodes nie wyd gebruik is om metamorfe proteïene te ondersoek nie. Aan die ander kant het ioon-mobiliteit massaspektrometrie van Ltn aan die lig gebring dat Ltn10 aansienlik meer buigsaam is as Ltn40 [114].

'N Aantal innoverende proteïen -ingenieurswese metodes is ook gebruik om die funksies van die twee voue metamorfe proteïensisteme te ontleed. Funksionele studies is belaai met probleme wanneer twee konformasies vinnig en omkeerbaar onderling omskakel, aangesien dit moeilik word om 'n proteïen-proteïen- of proteïen-ligand-interaksie aan een van die konformers toe te skryf. Volkman en kollegas het geslote weergawes van Ltn10 [33] en Ltn40 [32] gekonstrueer deur bykomende disulfiedkoppelings in te sluit om die een of die ander konformer te stabiliseer, en daardeur 'n kunsmatige kinetiese versperring vir die interomskakeling te genereer. Struktuurgeleide mutasies wat een konformasie selektief stabiliseer is ook beskikbaar vir al die ander metamorfiese proteïenstelsels wat hier bespreek word, wat 'n arsenaal van variante verskaf om struktuur-funksie-verwantskappe te verstaan.

6. Gevolgtrekking en perspektiewe

Proteïendinamika is sentraal vir funksie en is betrokke by wanfunksionering en siektes. Die konformasie heterogeniteit waargeneem in proteïene is 'n gevolg van die frustrasie inherent in proteïen konformasie vrye energie landskappe. Geen ander stelsel illustreer die buigbaarheid van hierdie landskappe beter as metamorfe proteïene nie, wat ontwikkel het om twee verskillende strukturele tersiêre voue te bevolk wat verskillende funksies kan hanteer.

Ons huidige begrip van metamorfe proteïene spruit uit komplementêre strukturele en evolusionêre benaderings, wat wissel van NMR-spektroskopie en röntgenkristallografie tot simulasies van molekulêre dinamika en heropbou van voorouers. Ons kon die strukture en funksies van die verskillende konforme toelig en ook in sommige gevalle hul omkeerbare omskakeling vasstel. Uit die beskikbare gegewens is dit duidelik dat die studie van metamorfe proteïene nie net van kardinale belang is om struktuur -funksieverhoudings te verstaan ​​nie, maar ook omdat metamorfe proteïene uitstekende modelstelsels is op gebiede so uiteenlopend soos strukturele en evolusionêre biologie.

Die gebied van metamorfe proteïene bly egter nog in sy kinderskoene 12 jaar na die invloedryke artikel van Murzin wat die term 'metamorfe proteïen' bedink [12]. Tipiese metamorfe proteïene toon tot dusver slegs twee konformasietoestande in ewewig. Of dit 'n beperking is van die metodologie wat ons tot ons beskikking het om veelvuldige verskillende konformasies op te spoor, of as dit 'n inherente beperking is wat deur die proteïenvrye energielandskap gestel word, bly onduidelik, en die graad van strukturele plastisiteit wat vertoon kan word deur 'n metamorfe proteïen is nog steeds 'n ope vraag. Inderdaad, daar is voorstelle in die literatuur dat MIV-1 omgekeerde transkriptase drie verskillende strukture kan aanneem [23]. Daar is 'n dringende behoefte om robuuste volgordegebaseerde voorspellings van metamorfe proteïensisteme te ontwikkel wat dan eksperimenteel gekarakteriseer kan word. Dit sal die weg baan om ons lys metamorfe proteïene te vergroot en om sistematiese studies uit te voer om temas en patrone te herken. Ons verstaan ​​ook baie min van die meganisme van inter -omskakeling van die verskillende strukture en hoe kompakte gevoude konformasies doeltreffend en omkeerbaar kan omskakel sonder om te aggregeer. Ten slotte, waar pas metamorfe proteïene in die breë struktuur van proteïen -evolusie? Is dit tussenprodukte wat op heterdaad betrap word, of is dit gesofistikeerde evolusionêre eindpunte wat deur seleksiedruk gevorm is om veelvuldige gevoude konformasies te bevoordeel? Dit is 'n paar van die opwindende vrae wat die gebied van metamorfe proteïene in die gesig staar, waarvan die antwoorde ons soeke na dieper insigte in die biomolekulêre struktuur, dinamika en evolusie sal bevorder.


Kon nie u gebruikerskoekie opstel nie

Hierdie webwerf gebruik webkoekies om werkverrigting te verbeter. As u blaaier nie koekies aanvaar nie, kan u nie hierdie webwerf sien nie.

Stel u blaaier in om koekies te aanvaar

Daar is baie redes waarom 'n koekie nie reg gestel kon word nie. Hier is die mees algemene redes:

  • Jy het koekies gedeaktiveer in jou blaaier. U moet u blaaier terugstel om koekies te aanvaar of om u te vra of u koekies wil aanvaar.
  • Jou blaaier vra jou of jy koekies wil aanvaar en jy het geweier. Gebruik die Terug -knoppie en aanvaar die koekie om koekies van hierdie webwerf af te aanvaar.
  • Jou blaaier ondersteun nie koekies nie. Probeer 'n ander blaaier as jy dit vermoed.
  • Die datum op u rekenaar is in die verlede. As u rekenaar se klok 'n datum voor 1 Januarie 1970 toon, sal die blaaier die koekie outomaties vergeet. Om dit reg te stel, stel die korrekte tyd en datum op jou rekenaar in.
  • Jy het 'n toepassing geïnstalleer wat monitor of blokkeer dat koekies gestel word. U moet die toepassing deaktiveer terwyl u aanmeld of met u stelseladministrateur in verbinding tree.

Waarom vereis hierdie webwerf koekies?

Hierdie webwerf gebruik koekies om werkverrigting te verbeter deur te onthou dat jy aangemeld is wanneer jy van bladsy tot bladsy gaan. Om toegang sonder koekies te bied, sal die webwerf 'n nuwe sessie moet skep vir elke bladsy wat u besoek, wat die stelsel tot 'n onaanvaarbare vlak vertraag.

Wat word in 'n koekie gebêre?

Hierdie webwerf stoor niks anders as 'n outomaties gegenereerde sessie -ID in die koekie nie, geen ander inligting word vasgelê nie.

Oor die algemeen kan slegs die inligting wat jy verskaf, of die keuses wat jy maak terwyl jy 'n webwerf besoek, in 'n koekie gestoor word. Die webwerf kan byvoorbeeld nie jou e-posnaam bepaal tensy jy kies om dit in te tik nie. Deur 'n webwerf toe te laat om 'n koekie te skep, gee dit nie toegang tot die res van u rekenaar nie, en slegs die webwerf wat die koekie geskep het, kan dit lees.