Inligting

Hoe om gesimuleerde massaspektrometrie data vir gefosforileerde proteïene te genereer?

Hoe om gesimuleerde massaspektrometrie data vir gefosforileerde proteïene te genereer?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Ek probeer gesimuleerde MS-data genereer (van bo-na-onder en onder-na-bo) vir gefosforileerde proteïen soos bloedplaatjie-afgeleide groeifaktorreseptor (PDGFR-B). Daar is 10 tirosienplekke wat gefosforileer is. Kan jy asseblief vir my sê of daar enige goeie sagtewaretoepassing is om my te help om dit te doen?

Ook, hoe kan ek in die invoerlêer (FASTA) insluit dat daar 10 wysigingsplekke op die proteïenvolgorde is?

Wat is die parameters wat nodig is om afsonderlik vir top-down en bottom-up MS ingestel te word?


Ek weet dit is 'n twee jaar oue vraag ... maar ek het onlangs 'n webtoepassing ontwikkel wat vir jou nuttig kan wees: Prot pi

Met die Proteïen-instrument kan jy die massaspektrum van die ongeskonde proteïen simuleer, terwyl die Peptide-instrument jou die fragmentione van peptiede gee. Wysigings kan maklik geheg word aan elke webwerf wat jy wil hê.


Vir peptiede (onder na bo) aanvaar mMass 'n reeks van belang en gefosforileerde tyrosien kan daarna as 'n wysiging gespesifiseer word. Die program tree ook op in silico ensiem verteer en in silico MS/MS fragmentasie.

Daar is ander instrumente wat probeer om die intensiteite van die verskillende fragmente wat gegenereer kan word akkuraat na te boots.

Die betekenis van die laaste vraag is onduidelik. As jy wil weet watter parameters om te stel vir die in silico ontledings wat jy nodig het om dié te gebruik wat ooreenstem met die monsterverwerking en ontledings wat in die werklike wêreld sou plaasvind. Monsterverwerking en instrumentopstelling is hoogs konteksafhanklik, daar is onvoldoende inligting om daarmee te help.

Die verkryging van goeie kwaliteit ongeskonde metings vanaf 'n proteïen die grootte van PDGFR-B sal 'n beduidende uitdaging wees.


Kyk bietjie na PeptideMass, jy kan kies om die "post-translasionele modifikasies" opsie te gebruik wat die massas gefosforileerde (onder andere modifikasies) peptiede sal uitstuur.


Abstrak

Die sistematiese en kwantitatiewe molekulêre analise van mutante organismes wat begin is deur studies oor mutante metabolome en transkriptome hou groot belofte in vir die verbetering van ons begrip van hoe fenotipes na vore kom. Ongelukkig, as gevolg van die beperkings van klassieke biochemiese analise, is proteïene voorheen van sulke studies uitgesluit. Hier kyk ons ​​na hoe tegniese vooruitgang in massaspektrometrie-gebaseerde proteomika toegepas kan word om veranderinge in proteïenoorvloed, posttranslasionele modifikasies en proteïen-proteïen-interaksies in mutante op die skaal van die proteoom te meet. Ons bespreek ten slotte voorbeelde wat proteomika-data integreer met genomiese en fenomiese inligting om netwerkgesentreerde modelle te bou, wat 'n belowende roete bied om te verstaan ​​hoe fenotipes na vore kom.


Amphitrite: 'n Program vir die verwerking van reizende golfioonmobiliteit massaspektrometrie data

Sedert die bekendstelling van reisgolf (T-Wave)-gebaseerde ioonmobiliteit in 2007 het 'n groot aantal navorsingslaboratoriums die tegniek omhels, veral dié wat in die veld van strukturele biologie werk. Die ontwikkeling van sagteware om die data wat uit hierdie tegniek gegenereer word te verwerk, is egter beperk. Ons bied 'n nuwe sagtewarepakket aan wat die verwerking van T-Wave-ioonmobiliteitsdata moontlik maak. Die program kan komponente in 'n massaspektrum deconvoluteer en gebruik hierdie inligting om ooreenstemmende aankomstydverspreidings (ATD's) te onttrek met minimale gebruikerintervensie. Dit kan ook gebruik word om outomaties 'n botsingsdwarssnit (CCS) kalibrasie te skep en dit toe te pas op daaropvolgende lêers van belang. 'n Aantal toepassings van die sagteware, en hoe dit die inligtinginhoud wat uit die rou data onttrek word, verbeter, word geïllustreer deur gebruik te maak van modelproteïene.

Grafiese abstrak

Hoogtepunte

► Ontwikkeling van die eerste sagteware om die verwerking van reizende golfioonmobiliteit massaspektrometrie (TWIM-MS) data te outomatiseer. ► Outomatiese skepping en toepassing van botsingsdwarssnitkalibrasie op TWIM-MS-data. ► Skep van fynkorrelige botsingsdwarssnit vs. m/Z hittekaarte wat tussen eksperimentele toestande oorgelê kan word.


Verwysings

Krishna, R. G. & Wold, F. Post-translasie-modifikasie van proteïene. Adv. Ensiemol. Verwant. Gebiede Mol. Biol. 67, 265–298 (1993).

Jensen, O. N. Modifikasie-spesifieke proteomika: karakterisering van post-translasionele modifikasies deur massaspektrometrie. Curr. Mening. Chem. Biol. 8, 33–41 (2004).

Mann, M. & Jensen, O. N. Proteomiese analise van post-translasionele wysigings. Nature Biotechnol. 21, 255–261 (2003).

Eichler, J. & Adams, M. W. Posttranslationele proteïenmodifikasie in Archaea. Mikrobiol. Mol. Biol. Ds. 69, 393–425 (2005).

Yang, X. J. Multisite proteïenmodifikasie en intramolekulêre sein. Onkogen 24, 1653–1662 (2005). 'n Uitstekende oorsig van multi-site PTM's en hul biologiese rolle.

Cohen, P. Die regulering van proteïenfunksie deur multisite-fosforilering - 'n 25 jaar-opdatering. Tendense Biochem. Wetenskap. 25, 596–601 (2000).

Gunawardena, J. Multisite proteïenfosforilering maak 'n goeie drempel, maar kan 'n swak skakelaar wees. Proc. Natl Acad. Wetenskap. VSA 102, 14617–14622 (2005).

Cosgrove, M. S., Boeke, J. D. & Wolberger, C. Gereguleerde nukleosoommobiliteit en die histoonkode. Natuurstruktuur. Mol. Biol. 11, 1037–1043 (2004).

Fischle, W., Wang, Y. & Allis, C. D. Binêre skakelaars en modifikasiekassette in histoonbiologie en verder. Natuur 425, 475–479 (2003).

Pokholok, D.K. et al. Genoomwye kaart van nukleosoomasetilering en metilering in gis. Sel 122, 517–527 (2005).

Fischle, W. et al. Regulering van HP1-chromatienbinding deur histoon H3 metilering en fosforilering. Natuur 438, 1116–1122 (2005).

Freitas, M. A., Sklenar, A. R. & Parthun, M. R. Toepassing van massaspektrometrie op die identifikasie en kwantifisering van histoon post-translasie-modifikasies. J. Sel. Biochem. 92, 691–700 (2004).

Insinga, A., Minucci, S. & Pelicci, P. G. Meganismes van selektiewe teenkankerwerking van histoon-deasetilase-inhibeerders. Selsiklus 4, 741–743 (2005).

Steen, H. & Mann, M. Die abc's (en xyz's) van peptiedvolgordebepaling. Natuur Ds Mol. Sel Biol. 5, 699–711 (2004). 'n Goeie inleiding tot die konsepte en metodes wat betrokke is by peptiedvolgordebepaling deur MS/MS.

Yates, J. R. 3rd, Gilchrist, A., Howell, K. E. & Bergeron, J. J. Proteomics van organelle en groot sellulêre strukture. Natuur Ds Mol. Sel Biol. 6, 702–714 (2005).

Aebersold, R. & Mann, M. Massaspektrometrie-gebaseerde proteomika. Natuur 422, 198–207 (2003).

Loughrey Chen, S. et al. Massaspektrometrie-gebaseerde metodes vir fosforileringsplekkartering van hiperfosforileerde proteïene toegepas op Net1, 'n reguleerder van uitgang van mitose in gis. Mol. Sel. Proteomika 1, 186–196 (2002).

Neubauer, G. & Mann, M. Kartering van fosforilering plekke van gel-geïsoleerde proteïene deur nano-elektrospray tandem massaspektrometrie: potensiale en beperkings. Anaal. Chem. 71, 235–242 (1999).

Unwin, R. D. et al. Meervoudige reaksiemonitering om plekke van proteïenfosforilering met hoë sensitiwiteit te identifiseer. Mol. Sel. Proteomika 4, 1134–1144 (2005).

Beausoleil, S. A. et al. Grootskaalse karakterisering van HeLa-selkernfosfoproteïene. Proc. Natl Acad. Wetenskap. VSA 101, 12130–12135 (2004).

Gruhler, A. et al. Kwantitatiewe fosfoproteomika toegepas op die gisferomoonseinweg. Mol. Sel. Proteomika 4, 310–327 (2005). 'n Grootskaalse kwantitatiewe fosfoproteomika-studie wat affiniteitsverryking en multi-stadium MS gebruik, onthul sommige van die sleutelseinmodules wat betrokke is by die gisferomoonreaksie.

Coon, J.J. et al. Proteïen-identifikasie deur gebruik te maak van opeenvolgende ioon-ioon reaksies en tandem massaspektrometrie. Proc. Natl Acad. Wetenskap. VSA 102, 9463–9468 (2005).

Sze, S. K., Ge, Y., Oh, H. & McLafferty, F. W. Top-down massaspektrometrie van 'n 29-kDa proteïen vir karakterisering van enige posttranslasionele modifikasie tot binne een oorblyfsel. Proc. Natl Acad. Wetenskap. VSA 99, 1774–1779 (2002).

Wu, SL, Kim, J., Hancock, WS & Karger, B. Uitgebreide reeks proteomiese analise (ERPA): 'n nuwe en sensitiewe LC-MS-platform vir hoë volgorde dekking van komplekse proteïene met uitgebreide post-translasionele wysigings - omvattende ontleding van β-kaseïen en epidermale groeifaktorreseptor (EGFR). J. Proteome Res. 4, 1155–1170 (2005).

Creasy, D. M. & Cottrell, J. S. Foutverdraagsame soektog na ongeinterpreteerde tandem-massaspektrometriedata. Proteomika 2, 1426–1434 (2002).

Matthiesen, R., Trelle, M. B., Højrup, P., Bunkenborg, J. & Jensen, O. N. VEMS 3.0: algoritmes en berekeningsgereedskap vir tandem-massaspektrometrie-gebaseerde identifikasie van post-translasie-modifikasies in proteïene. J. Proteome Res. 4, 2327–2337 (2005).

Sadygov, R. G., Cociorva, D. & Yates, J. R. 3de. Grootskaalse databasissoektog deur tandemmassaspektra te gebruik: soek die antwoord agter in die boek op. Natuur Metodes 1, 195–202 (2004).

Cantin, G. T. & Yates, J. R. 3de. Strategieë vir haelgeweer-identifikasie van post-translasie-modifikasies deur massaspektrometrie. J. Chromatogr. A 1053, 7–14 (2004).

Kirkpatrick, D. S., Denison, C. & Gygi, S. P. Weeg op ubiquitin: die groeiende rol van massaspektrometrie-gebaseerde proteomika. Nature Cell Biol. 7, 750–757 (2005). Uitstekende oorsig oor proteomika-benaderings vir die studie van ubiquitylation en proteïenmodifikasie deur ubiquitin-agtige modifiseerders.

Boeri Erba, E. et al. Sistematiese ontleding van die epidermale groeifaktorreseptor deur massaspektrometrie openbaar stimulasie-afhanklike multisite-fosforilering. Mol. Sel. Proteomika 4, 1107–1121 (2005).

Pandey, A. et al. Analise van reseptor seinweë deur massaspektrometrie: identifikasie van Vav-2 as 'n substraat van die epidermale en plaatjie-afgeleide groeifaktorreseptore. Proc. Natl Acad. Wetenskap. VSA 97, 179–184 (2000).

Salomon, A. R. et al. Profilering van tyrosienfosforileringsweë in menslike selle met behulp van massaspektrometrie. Proc. Natl Acad. Wetenskap. VSA 100, 443–448 (2003).

Blagoev, B., Ong, S. E., Kratchmarova, I. & Mann, M. Temporele analise van fosfotirosienafhanklike seinnetwerke deur kwantitatiewe proteomika. Nature Biotechnol. 22, 1139–1145 (2004). 'n Tydelike analise wat tripleks stabiele-isotoop-etikettering en MS gebruik het om EGF-geïnduseerde fosfotirosienseingebeure te bestudeer.

Rush, J. et al. Immunoaffiniteitsprofiel van tirosienfosforilering in kankerselle. Nature Biotechnol. 23, 94–101 (2005).

Gronborg, M. et al. 'n Massaspektrometrie-gebaseerde proteomiese benadering vir die identifisering van serien/treonien-gefosforileerde proteïene deur verryking met fosfo-spesifieke teenliggaampies: identifikasie van 'n nuwe proteïen, Frigg, as 'n proteïenkinase A-substraat. Mol. Sel. Proteomika 1, 517–527 (2002).

Kane, S. et al. 'n Metode om serienkinase-substrate te identifiseer. Akt fosforileer 'n nuwe adiposietproteïen met 'n Rab GTPase-aktiverende proteïen (GAP) domein. J. Biol. Chem. 277, 22115–22118 (2002).

Posewitz, M. C. & Tempst, P. Geïmmobiliseerde gallium (III) affiniteitschromatografie van fosfopeptiede. Anaal. Chem. 71, 2883–2892 (1999).

Stensballe, A., Andersen, S. & Jensen, O. N. Karakterisering van fosfoproteïene van elektroforetiese gels deur nanoskaal Fe(III) affiniteitschromatografie met aflyn massaspektrometrie-analise. Proteomika 1, 207–222 (2001).

Ficarro, S. B. et al. Fosfoproteoomanalise deur massaspektrometrie en die toepassing daarvan op Saccharomyces cerevisiae. Nature Biotechnol. 20, 301–305 (2002).

Nuhse, T. S., Stensballe, A., Jensen, O. N. & Peck, S. C. Grootskaalse analise van in vivo gefosforileerde membraanproteïene deur geïmmobiliseerde metaalioonaffiniteitschromatografie en massaspektrometrie. Mol. Sel. Proteomika 2, 1234–1243 (2003).

Zhang, Y. et al. Tyd-opgeloste massaspektrometrie van tirosienfosforileringsplekke in die epidermale groeifaktorreseptor-seinnetwerk openbaar dinamiese modules. Mol. Sel. Proteomika 4, 1240–1250 (2005).

Collins, M. O. et al. Proteomiese analise van in vivo gefosforileerde sinaptiese proteïene. J. Biol. Chem. 280, 5972–5982 (2005).

Pinkse, M. W., Uitto, P. M., Hilhorst, M. J., Ooms, B. & Heck, A. J. Selektiewe isolasie op die femtomole vlak van fosfopeptiede van proteolitiese vertering deur gebruik te maak van 2D-nanoLC–ESI–MS/MS en titaniumoksied prekolomme. Anaal. Chem. 76, 3935–3943 (2004).

Larsen, M. R., Thingholm, T. E., Jensen, O. N., Roepstorff, P. & Jorgensen, T. J. Hoogs selektiewe verryking van gefosforileerde peptiede uit peptiedmengsels met behulp van titaandioksiedmikrokolomme. Mol. Sel. Proteomika 4, 873–886 (2005).

Dube, D. H. & Bertozzi, C. R. Glycans in kanker en inflammasie - potensiaal vir terapeutika en diagnostiek. Natuur Eerw. Dwelmontdekking. 4, 477–488 (2005).

Wilson, N. L., Schulz, B. L., Karlsson, N. G. & Packer, N. H. Opeenvolgende analise van N- en O-gekoppelde glikosilering van 2D-PAGE-geskeide glikoproteïene. J. Proteome Res. 1, 521–529 (2002).

Harvey, D.J. Proteomiese analise van glikosilering: strukturele bepaling van N- en O-gekoppelde glikane deur massaspektrometrie. Deskundige ds Proteomics 2, 87–101 (2005). 'n Omvattende oorsig van MS-gebaseerde metodes vir glikoproteïen- en glikaananalise deur gebruik te maak van proteomika-benaderings.

Gabius, H. J., Andre, S., Kaltner, H. & Siebert, H. C. The sugar code: functional lectinomics. Biochim. Biofis. Acta 1572, 165–177 (2002).

Yang, Z. & Hancock, W. S. Benadering tot die omvattende ontleding van glikoproteïene geïsoleer uit menslike serum met behulp van 'n multi-lektien affiniteit kolom. J. Chromatogr. A 1053, 79–88 (2004).

Kaji, H. et al. Lektienaffiniteitsvaslegging, isotoopgekodeerde merking en massaspektrometrie om te identifiseer N-gekoppelde glikoproteïene. Nature Biotechnol. 21, 667–672 (2003).

Küster, B. & Mann, M. 18 O-etikettering van N-glikosileringsplekke om die identifikasie van gel-geskeide glikoproteïene te verbeter deur gebruik te maak van peptiedmassakartering en databasissoektog. Anaal. Chem. 71, 1431–1440 (1999).

Hagglund, P., Bunkenborg, J., Elortza, F., Jensen, O. N. & Roepstorff, P. 'n Nuwe strategie vir identifikasie van N-geglikosileerde proteïene en ondubbelsinnige toewysing van hul glikosileringsplekke deur gebruik te maak van HILIC-verryking en gedeeltelike deglikosilering. J. Proteome Res. 3, 556–566 (2004).

Küster, B., Krogh, T. N., Mortz, E. & Harvey, D. J. Glykosilasie-analise van gel-geskeide proteïene. Proteomika 1, 350–361 (2001).

Larsen, M. R., Hojrup, P. & Roepstorff, P. Karakterisering van gel-geskeide glikoproteïene met behulp van twee-stap proteolitiese vertering gekombineer met opeenvolgende mikrokolomme en massaspektrometrie. Mol. Sel. Proteomika 4, 107–119 (2005).

McLachlin, D. T. & Chait, B. T. Verbeterde β-eliminasie-gebaseerde affiniteit suiweringstrategie vir verryking van fosfopeptiede. Anaal. Chem. 75, 6826–6836 (2003).

Zhou, H., Watts, J. D. & Aebersold, R. 'n Sistematiese benadering tot die analise van proteïenfosforilering. Nature Biotechnol. 19, 375–378 (2001).

Tao, W.A. et al. Kwantitatiewe fosfoproteoomanalise deur gebruik te maak van 'n dendrimeer konjugasie chemie en tandem massaspektrometrie. Natuur Metodes 2, 591–598 (2005).

Brittain, S. M., Ficarro, S. B., Brock, A. & Peters, E. C. Verryking en ontleding van peptied subsets met behulp van fluorous affiniteit tags en massaspektrometrie. Nature Biotechnol. 23, 463–468 (2005).

Kho, Y. et al. 'n Merk-via-substraat-tegnologie vir opsporing en proteomika van gefarnesileerde proteïene. Proc. Natl Acad. Wetenskap. VSA 101, 12479–12484 (2004).

Sprung, R. et al. Tagging-via-substraat-strategie vir ondersoek O-GlcNAc-gemodifiseerde proteïene. J. Proteome Res. 4, 950–957 (2005).

Gevaert, K. et al. Verkenning van proteome en ontleding van proteïenverwerking deur massaspektrometriese identifikasie van gesorteerde N-terminale peptiede. Nature Biotechnol. 21, 566–569 (2003).

Van Damme, P. et al. Caspase-spesifiek en nie-spesifiek in vivo proteïenverwerking tydens Fas-geïnduseerde apoptose. Natuur Metodes 2, 771–777 (2005).

Welchman, R. L., Gordon, C. & Mayer, R. J. Ubiquitin en ubiquitin-agtige proteïene as multifunksionele seine. Natuur Ds Mol. Sel Biol. 6, 599–609 (2005).

Giannakopoulos, N.V. et al. Proteomiese identifikasie van proteïene gekonjugeer aan ISG15 in muis- en menslike selle. Biochem. Biofis. Res. Commun. 336, 496–506 (2005).

Ghezzi, P. & Bonetto, V. Redox proteomics: identifikasie van oksidatief gemodifiseerde proteïene. Proteomika 3, 1145–1153 (2003).

Aulak, K. S., Koeck, T., Crabb, J. W. & Stuehr, D. J. Proteomiese metode vir identifikasie van tyrosine-nitrated proteïene. Metodes Mol. Biol. 279, 151–165 (2004).

Kanski, J. & Schoneich, C. Proteïennitrasie in biologiese veroudering: proteomiese en tandem massaspektrometriese karakterisering van genitreerde terreine. Metodes Ensiemol. 396, 160–171 (2005).

Miyagi, M. et al. Bewyse dat lig proteïennitrasie in rotretina moduleer. Mol. Sel. Proteomika 1, 293–303 (2002).

Kanski, J., Hong, S. J. & Schoneich, C. Proteomiese analise van proteïennitrasie in veroudering van skeletspiere en identifikasie van nitrotirosienbevattende volgordes in vivo deur nano-elektrossproei ionisasie tandem massaspektrometrie. J. Biol. Chem. 280, 24261–24266 (2005).

MacCoss, M.J. et al. Haelgeweer-identifikasie van proteïenmodifikasies vanaf proteïenkomplekse en lensweefsel. Proc. Natl Acad. Wetenskap. VSA 99, 7900–7905 (2002).

Wu, C. C., MacCoss, M. J., Howell, K. E. & Yates, J. R. 3rd. 'n Metode vir die omvattende proteomiese analise van membraanproteïene. Nature Biotechnol. 21, 532–538 (2003).

Elortza, F. et al. Proteomiese analise van glikosielfosfatidielinositol-geankerde membraanproteïene. Mol. Sel. Proteomika 2, 1261–1270 (2003).

Steen, H., Jebanathirajah, J. A., Springer, M. & Kirschner, M. W. Stabiele isotoopvrye relatiewe en absolute kwantifisering van proteïenfosforileringsstoïgiometrie deur MS. Proc. Natl Acad. Wetenskap. VSA 102, 3948–3953 (2005).

Oda, Y., Huang, K., Cross, F. R., Cowburn, D. & Chait, B. T. Akkurate kwantifisering van proteïenuitdrukking en plekspesifieke fosforilering. Proc. Natl Acad. Wetenskap. VSA 96, 6591–6596 (1999).

Heck, A. J. & Krijgsveld, J. Massaspektrometrie-gebaseerde kwantitatiewe proteomika. Deskundige ds Proteomics 1, 317–326 (2004).

Gerber, S. A., Rush, J., Stemman, O., Kirschner, M. W. & Gygi, S. P. Absolute kwantifisering van proteïene en fosfoproteïene van sellisate deur tandem MS. Proc. Natl Acad. Wetenskap. VSA 100, 6940–6945 (2003).

Ross, P.L. et al. Vermenigvuldigde proteïen kwantifisering in Saccharomyces cerevisiae gebruik van amien-reaktiewe isobariese merkreagense. Mol. Sel. Proteomika 3, 1154–1169 (2004).

Krijgsveld, J. et al. Metaboliese etikettering van C. elegans en D. melanogaster vir kwantitatiewe proteomika. Nature Biotechnol. 21, 927–931 (2003).

Gruhler, A., Schulze, W. X., Matthiesen, R., Mann, M. & Jensen, O. N. Stabiele isotoop-etikettering van Arabidopsis thaliana selle en kwantitatiewe proteomika deur massaspektrometrie. Mol. Sel. Proteomika 4, 1697–1709 (2005).

Ibarrola, N., Molina, H., Iwahori, A. & Pandey, A. 'n Nuwe proteomiese benadering vir spesifieke identifikasie van tyrosienkinase-substrate deur gebruik te maak van [13C]-tirosien. J. Biol. Chem. 279, 15805–15813 (2004).

Ong, S.E. et al. Stabiele isotoop-etikettering deur aminosure in selkultuur, SILAC, as 'n eenvoudige en akkurate benadering tot uitdrukkingsproteomika. Mol. Sel. Proteomika 1, 376–386 (2002).

Zhu, H., Pan, S., Gu, S., Bradbury, E. M. & Chen, X. Aminosuurresidu-spesifieke stabiele isotoop-etikettering vir kwantitatiewe proteomika. Vinnige Gemeenskap. Massaspektrum. 16, 2115–2123 (2002).

Kratchmarova, I., Blagoev, B., Haack-Sorensen, M., Kassem, M. & Mann, M. Meganisme van divergente groeifaktor-effekte in mesenchimale stamseldifferensiasie. Wetenskap 308, 1472–1477 (2005).

Ballif, B.A. et al. Kwantitatiewe fosforileringsprofilering van die ERK/p90 ribosomale S6 kinase-seinkasset en sy teikens, die tuberous sklerose tumor onderdrukkers. Proc. Natl Acad. Wetenskap. VSA 102, 667–672 (2005).

Guo, D. et al. 'n Gebonde katalise, twee-hibriede sisteem om proteïen-proteïen-interaksies te identifiseer wat post-translasionele modifikasies vereis. Nature Biotechnol. 22, 888–892 (2004).

Ptacek, J. et al.Globale analise van proteïenfosforilering in gis. Natuur 438, 679–684 (2005).

Gorg, A., Weiss, W. & Dunn, M. J. Huidige tweedimensionele elektroforese-tegnologie vir proteomika. Proteomika 4, 3665–3685 (2004). 'n Oorsig van 2D-gelelektroforese, wat die toepassing daarvan op die studie van proteïendiversiteit en PTM's insluit.

Ge, Y. et al. Vermenigvuldigde fluoressensie-opsporing van fosforilering, glikosilering en totale proteïen in die proteomiese analise van borskanker-weerstandigheid. Proteomika 4, 3464–3467 (2004).

Meng, F., Forbes, A. J., Miller, L. M. & Kelleher, N. L. Opsporing en lokalisering van proteïenmodifikasies deur hoë resolusie tandem massaspektrometrie. Massaspektrum. Ds. 24, 126–134 (2005).

Hu, Q. et al. Die Orbitrap: 'n nuwe massaspektrometer. J. Massaspektrum. 40, 430–443 (2005).

Uhlen, M. et al. 'n Menslike proteïenatlas vir normale en kankerweefsels gebaseer op teenliggaamproteomika. Mol. Sel. Proteomika 4, 1920–1932 (2005).

Kelleher, N.L. et al. Lokalisering van labiele posttranslasionele modifikasies deur elektronvangsdissosiasie: die geval van y-karboksiglutamiensuur. Anaal. Chem. 71, 4250–4253 (1999).

Zubarev, R. A. Elektronvangende dissosiasie tandem massaspektrometrie. Curr. Mening. Biotegnologie. 15, 12–16 (2004).

Syka, J. E., Coon, J. J., Schroeder, M. J., Shabanowitz, J. & Hunt, D. F. Peptied- en proteïenvolgorde-analise deur elektronoordrag-dissosiasie-massaspektrometrie. Proc. Natl Acad. Wetenskap. VSA 101, 9528–9533 (2004).

Forbes, A.J. et al. Geteikende analise en ontdekking van posttranslasie-modifikasies in proteïene van metanogene archaea deur top-down MS. Proc. Natl Acad. Wetenskap. VSA 101, 2678–2683 (2004).

Zabrouskov, V., Giacomelli, L., van Wijk, K. J. & McLafferty, F. W. 'n Nuwe benadering vir plantproteomika: karakterisering van chloroplastproteïene van Arabidopsis thaliana deur top-down massaspektrometrie. Mol. Sel. Proteomika 2, 1253–1260 (2003).

Jones, P. et al. PRIDE: 'n openbare bewaarplek van proteïen- en peptiedidentifikasies vir die proteomika-gemeenskap. Nukleïensure Res. 34, D659–D663 (2006).

Orchard, S., Hermjakob, H., Taylor, C., Aebersold, R. & Apweiler, R. Menslike proteoomorganisasie proteomika-standaarde-inisiatief voorkongres-inisiatief. Proteomika 5, 4651–4652 (2005).

Peri, S. et al. Ontwikkeling van menslike proteïenverwysingsdatabasis as 'n aanvanklike platform vir die benadering van sisteembiologie by mense. Genoom Res. 13, 2363–2371 (2003).

Blom, N., Sicheritz-Ponten, T., Gupta, R., Gammeltoft, S. & Brunak, S. Voorspelling van post-translasie-glikosilering en fosforilering van proteïene van die aminosuurvolgorde. Proteomika 4, 1633–1649 (2004).

Chang, E. J., Archambault, V., McLachlin, D. T., Krutchinsky, A. N. & Chait, B. T. Analise van proteïenfosforilering deur hipotese-gedrewe meervoudige-stadium massaspektrometrie. Anaal. Chem. 76, 4472–4483 (2004).

Hjerrild, M. et al. Identifikasie van fosforileringsplekke in proteïenkinase A-substrate deur kunsmatige neurale netwerke en massaspektrometrie te gebruik. J. Proteome Res. 3, 426–433 (2004).

Nuhse, T. S., Stensballe, A., Jensen, O. N. & Peck, S. C. Phosphoproteomics of the Arabidopsis plasmamembraan en 'n nuwe fosforileringsplekdatabasis. Plantsel 16, 2394–2405 (2004).

Schwartz, D. & Gygi, S. P. 'n Iteratiewe statistiese benadering tot die identifikasie van proteïenfosforileringsmotiewe vanaf grootskaalse datastelle. Nature Biotechnol. 23, 1391–1398 (2005).

de Lichtenberg, U., Jensen, L. J., Brunak, S. & Bork, P. Dinamiese kompleksvorming tydens die gisselsiklus. Wetenskap 307, 724–727 (2005). Toon die krag van 'n integrerende berekeningsanalise van geenuitdrukkingsdata en proteïen-proteïeninteraksiedata vir die karakterisering van dinamiese, funksionele proteïenmodules.

Rual, J. F. et al. Op pad na 'n proteoomskaalkaart van die menslike proteïen-proteïeninteraksienetwerk. Natuur 437, 1173–1178 (2005).


Hoe om gesimuleerde massaspektrometrie data vir gefosforileerde proteïene te genereer? - Biologie

Connexins benodig 'n geïntegreerde netwerk vir proteïensintese, samestelling, poorting, internalisering, degradasie en terugvoerbeheer wat nodig is om die biosintese te reguleer, en omset van gap-aansluitingskanale. Op die mees fundamentele vlak lei die bekendstelling van volgorde-veranderende modifikasies veranderinge in proteïenkonformasie, aktiwiteit, lading, stabiliteit en lokalisering. Om die terreine, patrone en omvang van proteïen post-translasionele modifikasie te verstaan, insluitend fosforilering, is absoluut krities. Histories is die ondersoek van konneksienfosforilering binne die konteks geplaas dat een of klein aantal plekke van modifikasie streng ooreenstem met een molekulêre funksie. Die vrystelling van hoëprofiel-proteomiese datastelle blyk egter hierdie dogma uit te daag deur te demonstreer dat konneksiene verskeie vlakke van multi-plek fosforilering ondergaan. Met die groeiende prominensie van massaspektrometrie in biologie en medisyne, kry ons nou 'n blik op die rykdom van konneksienfosfaatseine. Met implikasies vir gesondheid en siekte, bied hierdie oorsig 'n oorsig van tegnologieë in die konteks van geteikende en ontdekkingsproteomika, en bespreek verder hoe hierdie tegnieke toegepas word om "die gapings te vul" in die begrip van konnexin post-translasiebeheer. Hierdie artikel is deel van 'n Spesiale Uitgawe getiteld: Die Kommunikerende aansluitings, rolle en disfunksies.

Hoogtepunte

► Ons verskaf 'n bygewerkte oorsig van massaspektrometrie (MS)-gebaseerde proteomika. ► Dit lyk asof Cx43 verskeie vlakke van multisite-fosforilering ondergaan. ► Bioinformatika toon dat die meerderheid van die terreine konsensus is oor veelvuldige kinases. ► Multisite-fosforileringsvolgorde en -orde verskaf insig in die Cx-kode.


'N STAP-VIR-STAP GIDS TOT DIE IDENTIFIKASIE EN ANALISE VAN FOSFORILASIE WERWE

Die volgende som sleutelstappe en oorwegings vir suksesvolle ontleding van fosforileringsplekke op individuele proteïene op. Ons neem hier aan dat die kinase van belang sy teiken onafhanklik van ander kinases fosforileer, wat gewoonlik die geval is. Sommige kinases kan egter slegs proteïene fosforileer wat voorheen deur 'n ander kinase "geprimeer" is, wat in vitro rekonstitusie van fosforilering en ontleding van fosforileringsplekmutante aansienlik kan bemoeilik.

Stap 1: Optimalisering van toetse vir opsporing van fosforileringsgebeure in vivo en in vitro

'n Belangrike eerste stap is om metodes vir die opsporing van fosforileringsgebeure te optimaliseer. Die gerieflikste manier om proteïenfosforilering op te spoor is deur elektroforetiese mobiliteitsverskuiwing. Opsporing is vinnig en eenvoudig, werk op proteïene wat in vivo en in vitro gemodifiseer is, en stel 'n mens in staat om die stoigiometrie van fosforilering te bepaal bloot deur die fraksie van verskuifde proteïen te bepaal. 'n Beperking van hierdie benadering is dat baie fosforileringsgebeure nie 'n verskuiwing in elektroforetiese mobiliteit veroorsaak nie. Fosforilasie-geïnduseerde verskuiwings in elektroforetiese mobiliteit is waarskynlik as gevolg van plaaslike konteks-afhanklike effekte op die buigsaamheid van die peptiedketting eerder as aan veranderinge in molekulêre gewig of algehele lading. As gevolg hiervan is die effekte van fosforilering op elektroforetiese mobiliteit onvoorspelbaar. Empiriese manipulasie van die verhouding van akrielamied tot bisakrielamied kan resolusie van verskillende gefosforileerde vorms van 'n proteïen (Nishiwaki) verbeter et al., 2007). Boonop kan 'n onlangs ontwikkelde metode vir die inkorporering van 'n fosfaatbindende molekule (genoem Phos-Tag) in poliakrielamiedgels hoë-resolusie opsporing van veelvuldige fosforileringsgebeure toelaat (Kinoshita) et al., 2006, 2012). Iso-elektriese fokus kan ook 'n hoë resolusie van verskeie werwe bied. Alhoewel dit meer arbeidsintensief is, werk iso-elektriese fokus op die meeste proteïene en kan inligting verskaf oor hoeveel fosfate vir elke lading isovorm geheg is.

Inkorporering van 32P hetsy in vitro of in vivo is hoogs sensitief maar verskaf geen inligting oor die stoigiometrie van fosforilering van individuele plekke nie. 'n Voordeel van in vivo-etikettering met 32P is egter dat dit binne minder as 'n week definitiewe resultate kan lewer of 'n proteïen in vivo gefosforileer is (metodes beskikbaar in Cooper et al., 1984 Den Haese et al., 1995). Immunoblotting met fosfospesifieke teenliggaampies is nog 'n algemene metode om fosforilering te monitor. Nie alle terreine kan egter met hierdie benadering opgespoor word nie. Effektiewe teenliggaampies wat fosfotirosien herken, is vir >20 jaar beskikbaar. Daar bestaan ​​egter geen vergelykbare betroubare teenliggaampies vir die opsporing van fosfoserien of fosfotreonien nie. 'n Aantal teenliggaampies wat gefosforileerde residue herken binne spesifieke kort lineêre motiewe is beskikbaar. Hierdie fosfomotief-teenliggaampies kan gebruik word om fosforilering op te spoor as gevolg van sekere klasse kinases (Zhang et al., 2002a).

Om fosforilering te bewaar, is dit noodsaaklik dat ekstrakbuffers en SDS–PAGE-monsterbuffers hoë konsentrasies fosfatase-inhibeerders bevat. Natriumfluoried en β-gliserolfosfaat, wat saam teen onderskeidelik 50 en 100 mM gebruik word, is goeie goedkoop opsies.

Sodra 'n terrein geïdentifiseer is, kan dit moontlik wees om fosfospesifieke teenliggaampies te genereer wat die terrein en sy omliggende konteks herken. Hierdie kragtige reagense laat vinnige opsporing van die terrein in vivo en in vitro toe, maar hul produksie is duur en nie gewaarborg nie. In ons kollektiewe ervaring het slegs 50% van fosfopeptiede bruikbare fosfospesifieke teenliggaampies opgelewer. Daarbenewens verskaf sulke teenliggaampies geen inligting oor die stoïgiometrie van fosforilering nie.

Stap 2: Identifikasie van die kinase of kinases wat direk op die proteïen van belang inwerk

Oorweeg die konsensusherkenningsplek van die kinase van belang. Alhoewel dit ver van perfek is, is daar baie duidelike voorbeelde van werfvoorkeure, en daar is goeie rekenaarhulpmiddels om konsensuswebwerwe te ondersoek (bv. http://elm.eu.org/, http://netphorest.info/, http:/ /scansite.mit.edu/Songyang et al., 1994 Yaffe et al., 2001 Obenauer et al., 2003 Miller et al., 2008 Dinkel et al., 2012). Pasmaats tussen gekarteerde fosforileringsplekke en die minimale konsensusherkenningsplek vir die kinase wat bestudeer word, verhoog vertroue dat die relevante kinase by sy teikenplekke aangepas is.

Verlies-van-funksie of wins-van-funksie mutasies of klein interfererende/kort haarnaald-RNA-afbreek van die kinase behoort die voorspelde effekte op fosforilering van die vermeende teikenproteïen te hê. Natuurlik moet 'n mens bewus wees van potensiële oortolligheid tussen kinases, wat die analise kan bemoeilik.

Kinase katalitiese domeine toon oor die algemeen nie 'n beduidende affiniteit vir hul teikenproteïene nie, maar baie kinases assosieer met hul teikens via sekondêre koppelplekke (sien byvoorbeeld Choi et al., 1994 Mortensen et al., 2002 Harvey et al., 2005 Dard en Peter, 2006). Die opsporing van bindingsinteraksies tussen die kinase en 'n vermeende teiken verhoog dus die vertroue dat die proteïen 'n direkte teiken is.

Gesuiwerde kinase behoort in staat te wees om die teikenproteïen doeltreffend en kwantitatief op 'n biologies relevante tydskaal in vitro te fosforileer. As kwantitatiewe fosforilering 'n 10-voudige oormaat kinase en 'n 2-uur reaksietyd vereis, maar sein in vivo vind binne minute plaas, is die proteïen dalk nie 'n direkte teiken nie of addisionele faktore word vereis.

Die nakoming van hierdie kriteria is relatief eenvoudig in gis, en daarom is gis onontbeerlike organismes vir seinanalise. Dit kan moeiliker wees om aan al die kriteria in dierselle te voldoen, maar 'n mens moet daarna streef om aan soveel as moontlik te voldoen.

Stap 3: Kartering van terreine wat in vitro gefosforileer is

Die beste karteringsresultate kom van 'n benadering wat data wat in vivo en in vitro verkry is, kombineer. Dit is dus verkieslik om 'n in vitro gerekonstitueerde sisteem te ontwikkel om gefosforileerde proteïen vir analise te genereer. Om goeie volgorde dekking en kwaliteit spektra te verkry wat hoë-vertroue fosfopeptied passings lewer, is dit die beste om soveel gefosforileerde proteïen as moontlik te verkry. Die hoeveelheid beginmateriaal wat benodig word vir suksesvolle ontleding sal baie verskil, maar 'n "meer is beter"-reël moet geld. Hoë-besetting plekke op MS-vriendelike peptiede kan waarneembaar wees vanaf so min as 2 pmol totale proteïen (~100 ng van 'n 50-kDa proteïen), maar baie hoër vlakke (≥10 pmol) word dikwels vereis.

Ideaal gesproke moet kontroles uitgevoer word wanneer die in vitro-stelsel gevestig word om te verseker dat die kinase van belang direk verantwoordelik is vir fosforilering van die proteïen. Gebruik van 'n kinase-dooie kontrole, spesifieke kinase-inhibeerders, of analoog-sensitiewe kinase mutante kan help om die moontlikheid uit te sluit dat fosforilering te wyte is aan 'n medesuiwerende kinase.

'n Mens moet ook oorweeg of die geïsoleerde substraatproteïen reeds gefosforileer is, moontlik deur veelvuldige kinases. Indien wel, moet die proteïen tydens suiwering met fosfatase behandel word. Indien die proteïen deur affiniteitschromatografie geïsoleer word, kan dit bereik word deur die proteïen met lambda- of kalfdermfosfatase te behandel terwyl dit nog aan die affiniteitskorrels gebind is. Selfs proteïene wat in bakterieë geproduseer word, het soms nie-spesifieke fosforilering ondergaan en moet dalk met fosfatase behandel word voordat dit as 'n substraat gebruik word.

Twee reaksies moet uitgevoer word: een wat kinase bevat, en 'n verwysingsreaksie wat geen kinase of 'n kinase-dooie mutant bevat nie. As 'n mens proteïen gebruik wat deur SILAC gemerk is, word die verwysings- en eksperimentele reaksies gekombineer na die reaksies en moet gelyke hoeveelhede proteïen bevat wat met swaar of ligte isotoop gemerk is. Die gekombineerde reaksies word direk deur massaspektrometrie na proteasebehandeling ontleed om plekke wat deur die kinase gefosforileer is, te identifiseer. Alternatiewelik kan die gekombineerde reaksies opgelos word deur elektroforese, en die band wat die proteïen van belang verteenwoordig kan uitgesny en deur massaspektrometrie geanaliseer word om vlakke van fosforilering te vergelyk, wat opsporing in sommige gevalle kan verbeter. As 'n mens nie SILAC gebruik nie, kan die kinase- en kontrolereaksies onafhanklik met massamerkers gemerk word, gekombineer en ontleed word.

As 'n aanvulling tot massaspektrometrie-analise kan fosfoaminosuuranalise toegepas word op die proteïen van belang wat uit 32P-gemerkte selle geïsoleer is of na in vitro fosforilering deur spesifieke kinases (Kamps en Sefton, 1989). Byvoorbeeld, as fosfoaminosuur-analise aan die lig bring dat die proteïen van belang op beide serien- en treonienresidu in vivo en in vitro gefosforileer is, maar massaspektrometrie-analise identifiseer slegs serien-fosforileringsplekke, kan dit wees dat potensieel belangrike modifikasies gemis is omdat die ooreenstemmende treonien fosfopeptiede kon nie deur massaspektrometrie opgespoor word nie. Net so kan tweedimensionele fosfopeptiedkartering 'n gevoel gee van die kompleksiteit van fosforilering, sowel as 'n manier om te toets of alle belangrike plekke van fosforilering na mutagenese geïdentifiseer is, sonder die behoefte aan komplekse massaspektrometrie-eksperimente (Boyle et al., 1991). Klassieke fosfopeptiedkartering het ook die voordeel dat al die fosfopeptied opgespoor word, in teenstelling met massaspektrometrie.

Stap 4: Kartering van terreine wat in vivo gefosforileer is

Om te bepaal of fosforileringsplekke wat in vitro geïdentifiseer is, relevant is, is dit belangrik om aan te toon dat hulle ook in vivo gefosforileer is. 'n Aantal databasisse katalogus webwerwe wat gevind is dat hulle in vivo gefosforileer is in grootskaalse opnames, so 'n maklike eerste stap is om te bepaal of terreine wat in vitro geïdentifiseer is reeds in vivo geïdentifiseer is, terwyl in gedagte gehou word dat grootskaalse opnames lae-volgorde dekking en mis baie werwe (vir databasisse sien PhosphoSitePlus, Phospho.ELM, en PHOSIDA).

Om terreine wat in vivo gefosforileer is, te karteer, moet 'n mens eers fisiologiese toestande definieer waaronder 'n beduidende fraksie van die proteïen gefosforileer word. Dit kan behels die behandeling van selle met 'n stimulus wat sein of sinchroniserende selle in die selsiklus aktiveer. 'n Ander benadering is om die seinweg geneties te manipuleer sodat die kinase van belang hiperaktiveer word. 'n Ideale situasie is wanneer 'n mens die substraatproteïen kan suiwer uit kontroleselle, selle waarin die betrokke kinase hiperaktiveer is, en selle waarin die betrokke kinase geïnaktiveer is, wat 'n mens in staat stel om te bepaal watter plekke afhanklik is van die kinase van belang in vivo .

Sodra die toepaslike toestande gedefinieer is, moet die substraatproteïen gesuiwer word onder toestande wat fosforilering bewaar en voldoende hoeveelhede proteïen lewer. Vir die beste resultate moet 'n mens mik na ≥10 pmol proteïen. Affiniteitssuiweringsmetodes wat spesifieke vrystelling van die gesuiwerde proteïen toelaat, sal die beste resultate lewer. Byvoorbeeld, proteïene gemerk met hemagglutinien of FLAG kan gesuiwer word met behulp van teenliggaampale en geëlueer word met 'n oormaat peptied (Ho et al., 2002 Harvey et al., 2011). Tandem affiniteit suiwering (TAP), multifunksionele TAP, of ander affiniteit-gebaseerde etikette kan ook gebruik word (Rigaut et al., 1999 Ma et al., 2012). Suiwering van proteïene deur gebruik te maak van teenliggaampies wat teen die proteïen van belang opgewek is, kan problematies wees omdat eluering van die teenliggaam strawwe toestande vereis wat ook groot hoeveelhede teenliggaampies uit die krale vrystel, wat die analise bemoeilik, alhoewel hierdie probleem omseil kan word deur die teenliggaampies te kruisbind aan krale. Nie-spesifieke eluerings genereer ook 'n hoër agtergrond van kontaminante proteïene wat kan inmeng met teikenpeptied opsporing.

Om fosforilering te bewaar, moet suiwering uitgevoer word in buffers wat hoë konsentrasies sout en fosfatase-inhibeerders bevat. Hoë soutkonsentrasies help om fosfatases te inhibeer en nie-spesifieke binding te verminder, terwyl fosfatase-inhibeerders defosforilering tydens suiwering verminder.

Stap 5: Interpretasie van fosforilering-plek kartering data

Massaspektrometrie-analise sal 'n lys van geïdentifiseerde terreine oplewer. Dit moet 'n telling van peptied spektrale passings (PSM'e) insluit, wat elkeen 'n unieke MS/MS spektrum verteenwoordig wat ooreenstem met 'n peptied wat daardie terrein bevat, en puntetelling parameters vir peptied identifikasie en plek lokalisering. Peptied identifikasie data word gereeld gefiltreer tot ~1% vals-ontdekking koers deur gebruik te maak van die teiken lok strategie (Elias en Gygi, 2007). Navorsers moet bewus wees dat die data verkeerde passings sal bevat. Die waarneming van veelvuldige PSM's vir 'n gegewe terrein, hetsy deur veelvuldige waarnemings van dieselfde peptied of die opsporing van verskillende peptiedvolgordes wat dieselfde plek huisves, versterk die vertroue van korrekte plektoewysing. Soos vroeër bespreek, kan terreinopdragte in baie gevalle nie altyd tot 'n enkele oorskot opgelos word nie. In sommige gevalle, byvoorbeeld, waar die studie gefokus is op 'n kinase met 'n bekende konsensusmotief, kan plaaslike volgorde gebruik word om die keuse van terreine te lei om na te streef vir verdere validering. In die meeste gevalle moet alle moontlike plekke op elke peptied egter oorweeg word.Terreine wat beide in vivo en in vitro gefosforileer is, het hoë vertroue om relevante terreine te wees. Werwe wat in besetting verander in reaksie op veranderinge in relevante stroomop seine is ook hoë-vertroue webwerwe. Nog 'n oorweging wat die vertroue kan verhoog dat korrekte identifikasie gemaak is, is die bewaring van die fosforileringsterrein(e) regdeur evolusie. Alhoewel proteïene wat by veelvuldige terreine binne ongestruktureerde streke gefosforileer is, moontlik nie evolusionêre bewaring van fosforileringsterreine toon nie, word fosforileringsterreine binne gevoude domeine dikwels bewaar (Landry et al., 2009 Niu et al., 2012).

Fosforilasie-terrein kartering skerms is byna nooit versadig. Versuim om 'n terrein waar te neem is onvoldoende bewyse om tot die gevolgtrekking te kom dat die terrein nie in die sel gefosforileer is nie. Baie faktore, insluitend lengte, hidrofobisiteit en lading, beïnvloed die chromatografiese eienskappe en ionisasie doeltreffendheid en dus die maklike opsporing van verskillende peptiede. Fosfo- en niefosfovorme van dieselfde peptied kan baie verskillende seinintensiteite hê. Dus is selfs die waarneming van 'n ongefosforileerde peptied geen waarborg dat die gekorreleerde fosfopeptied maklik opspoorbaar is nie. Ten spyte van hierdie waarskuwings, verskaf die ongefosforileerde peptiedvolgordebedekking steeds 'n aanduiding van die diepte van analise. Met voldoende hoeveelhede proteïen, en met die uitsondering van lang stukke van onhandelbare volgorde, behoort dit moontlik te wees om ≥80% aminosuurbedekking te bereik. Laer dekking verminder die vertroue dat alle terreine geïdentifiseer is en dui dikwels aan dat meer proteïen of 'n bykomende protease nodig is om peptiede vir die analise te genereer.

Vir kwantitatiewe eksperimente sal die data oorvloedverhoudings vir elke fosfopeptied insluit tesame met seinintensiteite, dikwels aangeteken as 'n sein-tot-geraas-verhouding. Anders as proteïenvlakanalise, waarin veelvuldige gekwantifiseerde peptiede dikwels waargeneem word, word fosfopeptiede meer gereeld opgespoor en slegs een keer gekwantifiseer. Daar is 'n sterk korrelasie tussen seinsterkte en reproduceerbaarheid. By die keuse van terreine vir verdere studie, moet ondersoekers baie aandag gee aan die aantal PSM's en die seinsterkte vir peptiede wat elke terrein huisves. Daar moet ook op gelet word dat die samestelling van verhoudings op terreinvlak uit veelvuldige peptiedmetings nie altyd triviaal is nie. Om bloot gemiddeldes of mediane te bereken van alle peptiede wat 'n gegewe plek bevat, sal dalk nie die volle kompleksiteit van sellulêre fosforileringspatrone openbaar nie. Enkel- en dubbelgefosforileerde vorms van 'n peptied kan op verskillende vlakke teenwoordig wees. Mens moet ook nie vergeet dat veranderinge in totale proteïenvlak nie in die fosfopeptiedverhoudings weerspieël word nie. Waar moontlik, moet aparte proteïenvlakmetings gemaak van ongemodifiseerde peptiede uitgevoer word en gebruik word om fosfopeptiedverhoudings te normaliseer.

Stap 6: Analise en interpretasie van fosforilasie-plek mutante

Na identifikasie van alle fosforileringsplekke moontlik en hul toewysing aan waarskynlike proteïenkinases, is die volgende stap om die plekke te muteer sodat hul biologiese betekenis vasgestel kan word. Tipies word serien- en treonienfosfosiete gemuteer na alanien (of valien vir treonien), en tirosienfosforileringsplekke word na fenielalanien gemuteer. Omdat massaspektrometrie terreine kan mis, is dit belangrik om te verifieer dat die meeste of alle sleutelpersele geïdentifiseer en gemuteer is. As die mutante proteïen sy SDS-PAGE-verskuiwing verloor, is dit waarskynlik dat die meeste plekke geïdentifiseer is. Dit sluit egter nie die moontlikheid uit dat sommige webwerwe gemis is wat nie 'n verskuiwing veroorsaak nie. Dus is 'n strenger benadering om aan te toon dat die mutante proteïen nie daarin slaag om 32P in 'n gerekonstitueerde in vitro sisteem te inkorporeer nie of dat die relevante fosfopeptied geïdentifiseer deur in vivo, 32P-gemerkte, tweedimensionele fosfopeptiedkartering verdwyn. Dit kan soms ook insiggewend wees om serien vir treonienreste om te skakel of omgekeerd. Baie proteïenkinases onderskei nie serien van treonien nie, en as die terrein in vivo geteiken word, behoort die proteïen se jelverskuiwing nie verlore te gaan met hierdie skakelaar nie, en tog kan 'n verandering in fosfoaminosuurinhoud van die ooreenstemmende peptied geredelik geïdentifiseer word, wat dit moontlik maak. een om direk te verifieer dat die betrokke fosforileringsplek geïdentifiseer is.

As 'n fosforileringsplek-mutant 'n verlies aan funksie veroorsaak, kan daar kommer wees dat dit nie-spesifieke skade aan die proteïen veroorsaak. Die oorgrote meerderheid van fosforileringsplekke kom voor in streke van proteïene wat voorspel word om versteurd te wees, so dit is onwaarskynlik dat fosforilasie-plek mutante proteïenstruktuur ontwrig (Iakoucheva) et al., 2004 Gsponer et al., 2008). Daarbenewens kan 'n aantal kriteria gebruik word om hierdie moontlikheid uit te skakel. Byvoorbeeld, as normale vlakke van die proteïen in vivo uitgedruk word, is dit waarskynlik dat die proteïen normale vou ondergaan, aangesien proteïene wat nie korrek kan vou nie, vernietig word. Nog 'n nuttige toets is om te bepaal of die fosforilasie-plek mutant 'n subset van normale funksies behou, wat sou aandui dat die mutante spesifieke funksies van die proteïen beïnvloed. As die proteïen normale lokalisering toon, behou dit duidelik sleutelfunksies.

Dit het algemeen geword in proteïenfosforreguleringstudies om fosforileringsplekke na "fosfomimetiese" residue te muteer in 'n poging om die konstitutief gefosforileerde toestand te bestudeer. In hierdie benadering word serien en treonien tipies gemuteer na asparagin- of glutamiensuurreste, terwyl tirosien met glutamiensuur vervang word. Hierdie benadering het twee beduidende tekortkominge. Eerstens, as die fosforileringsplek dien as 'n herkenningsein vir 'n adapterproteïen (d.w.s. 14-3-3, FHA-domein, PTB-domein en SH2-domeinproteïene), sal fosfomimetiese mutante nie aan die adapterproteïen bind nie (Durocher). et al., 1999 Zisch et al., 2000 Roberts-Galbraith et al., 2010) omdat hulle nie in die bindsak pas nie (van der Geer en Pawson, 1995 Yaffe et al., 1997 Durocher et al., 1999). Tweedens, die negatiewe lading wat deur aspartaat- of glutamaatsubstitusies (−1) ingebring word, stem nie ooreen met dié van die gefosforileerde residu (gewoonlik -1.5) by fisiologiese pH nie. Naburige pare aspartiensuur- of glutamatiesuur-sykettings kan die ladingsdifferensiaal oorkom en kan as beter fosfomimetika optree (Strickfaden et al., 2007 Pearlman et al., 2011). Die grootte van die ioniese dop wat deur 'n fosfaatgroep geproduseer word, verskil egter ook, en dus verskil die algehele chemiese omgewing wat deur fosforilering geskep word, baie van dié van negatief gelaaide aminosure (Hunter, 2012). Dit is dus nie verbasend dat fosfomimetiese mutasies dikwels nie daarin slaag om die veranderinge aan 'n proteïen wat deur fosforilering veroorsaak word, te reproduseer nie. As gevolg van hierdie twee beperkings kan die gedrag van fosfomimetiese mutasies oninterpreteerbaar wees. Natuurlik is daar voorbeelde waarin fosfomimetiese substitusies hoogs insiggewend was. Die konstitutiewe aktivering van MEK-kinases deur 'n fosfomimetiese mutasie is 'n uitstekende voorbeeld (McKay en Morrison, 2007).


Thermal Proximity Coaggregation (TPCA)

Thermal Proximity Coaggregation (TPCA) is 'n relatief onlangse en onkonvensionele benadering vir proteoomwye profilering van proteïenkompleksdinamika [87]. Dit ontgin die verskynsel dat interaktiewe proteïene saam-aggregeer na hitte-geïnduseerde denaturasie en mede-presipiteer. As gevolg hiervan het hulle 'n hoë ooreenkoms in hul termiese oplosbaarheid in vergelyking met nie-interaksie proteïene. Die samestellingstoestand van bekende proteïenkomplekse kan afgelei word uit die ooreenkoms of veranderinge in proteïen se termiese oplosbaarheid om dié te identifiseer wat oor sellulêre toestande of fisiologiese toestande gemoduleer is. Om die dinamika vir honderde tot duisende proteïenkomplekse gelyktydig te monitor, word proteoomwye kwantifisering van proteïentermiese oplosbaarheid bepaal deur gebruik te maak van kwantitatiewe MS, soortgelyk aan dié van termiese proteoomprofilering [88], wat isobariese TMT (tandemmassamerker) reagense gebruik om gelyktydig kwantifiseer proteïenoplosbaarheid oor tien verskillende temperature uit CETSA (Cellular Thermal Shift Assay) eksperimente [89] (Fig. 5).

Die TPCA-werkvloei. TPCA kan op ongeskonde selle of sellisaat uitgevoer word. Gelyste monsters word eers in 'n gelyke hoeveelheid aliquots verdeel en aan hittebehandeling met 'n toenemende temperatuurgradiënt onderwerp. Hittebehandeling veroorsaak denaturering en samevoeging van interaksie proteïene, wat dan saampresipiteer. Met sentrifugering word die supernatant wat uit oplosbare proteïene van verskillende temperatuurbehandeling bestaan, herwin vir isobariese TMT-etikettering en kwantitatiewe LC–MS/MS-analise. Die oorvloed van elke oplosbare proteïen wat geïdentifiseer en gekwantifiseer is, word dan teen die temperature geplot om die "proteïensmeltkurwe" te genereer

Huidige implementering van TPCA gebruik die CETSA-protokol [90] om proteïene te denatureer en die oplosbare fraksie te onttrek, gevolg deur TPP vir proteoomwye kwantifisering van proteïenoplosbaarheid [91]. Wanneer die termiese oplosbaarheid van proteïene teen stygende temperature geplot word, kan die sogenaamde smeltkurwe van proteïene gekonstrueer word om TPCA-handtekening oor seltipes of toestande te visualiseer. Die ooreenkoms in termiese oplosbaarheid van proteïene tussen pare proteïene oor verskeie temperature kan gekwantifiseer word deur maatreëls soos Euklidiese afstand [87] en Pearson se korrelasie [92] te gebruik. Statistiese betekenisvolheid van waargenome ooreenkomste en veranderinge in termiese oplosbaarheid tussen pare proteïene word beraam deur 'n bootstrapping-benadering met behulp van ewekansige pare proteïene om ewekansige agtergrondverspreiding te vestig [87].

Deur TPP- en CETSA-protokolle te gebruik, kan data vir TPCA-analise verkry word van beide sellysaat en ongeskonde selle. In eersgenoemde word selle eers gelys voor hittedenaturering, terwyl in laasgenoemde ongeskonde selle eers verhit word voor sellise. In die eerste bewys-van-konsep-werk wat demonstreer dat TPCA gebruik kan word om proteïenkomplekse te identifiseer wat oor seltipes, sellulêre toestande en sellulêre toestande gemoduleer is, is waargeneem dat proteïenkomplekse baie sterker TPCA-handtekening vertoon (dws samevoeging) in data van ongeskonde selle as van sellisaat. As die eerste bewys-van-konsep-eksperiment, is TPCA uitgevoer om proteïenkomplekse te identifiseer wat oor verskillende seltipes, sellulêre toestande en sellulêre toestande gemoduleer is [87]. Die finale resultate het getoon dat proteïenkomplekse verkry uit ongeskonde selle 'n hoër vlak van ko-aggregasie (sterker TPCA-handtekening) vertoon het as dié wat van sellisaat afkomstig is [87]. Hierdie waarneming dui daarop dat die integriteit van proteïenkomplekse moontlik gekompromitteer is na sellise. Veral, vir baie proteïenkomplekse wat TPCA-handtekening slegs in ongeskonde selle vertoon, word hulle dikwels geassosieer en waarskynlik afhanklik van subsellulêre steiers soos chromatien en membraan vir strukturele stabiliteit, wat waarskynlik afwesig is in sellisaat. Saamgevat dui hierdie waarnemings daarop dat TPCA waardevol sal wees vir die bestudering van proteïenkomplekse in situ, veral vir swakbindende proteïenkomplekse wat maklik dissosieer na sellise. Dit is belangrik dat TPCA die subkomplekse organisasie van megakomplekse soos die kernporiekompleks en die proteasoom kan openbaar [87, 92]. Daar is ook gerapporteer dat fosforilering die termiese oplosbaarheid van proteïen kan beïnvloed deur PPI's te moduleer, wat die vermoë voorstel om fosforilasie-afhanklike proteïenkomplekse [93] te identifiseer. Interessant genoeg, soortgelyk aan CETSA en TPP, is dit ook getoon dat TPCA-analise uitgebrei kan word na in vivo monsters soos weefsels en bloedmonsters [87, 94].

TPCA vir sisteemwye profilering van proteïenkompleksdinamika het die voordele dat dit nie teenliggaampies of epitoopmerking vereis nie. Dit verg min voorbereidingstyd in vergelyking met bestaande metodes, en bowenal, laat die studie van proteïenkomplekse in situ en in vivo toe. Die huidige weergawe van TPCA kan ontplooi word om die dinamika van bekende of voorspelde proteïenkomplekse oor sellulêre toestande en fisiologiese toestande doeltreffend te bestudeer, maar moet bestaande interaksiedata met grafiek/netwerkgroeperingsalgoritmes inkorporeer om nuwe proteïenkomplekse te identifiseer. Nietemin, Hashimoto et al. onlangs gedemonstreer nuwe proteïen-proteïen interaksies kon afgelei word onder die klein stel virale proteïene met behulp van slegs TPCA data [95]. Grootskaalse menslike interaktoomprojekte en integrerende data-analise het baie nuwe maar funksioneel ongekarakteriseerde proteïenkomplekse ontbloot. TPCA-profilering kan vinnig ontplooi word om die samestellingstoestand van hierdie proteïenkomplekse oor sellulêre toestand, seltipe, weefsel en fisiologiese toestande te ontrafel om insig te gee in hul funksies in normale en siek selle. Die termiese proteïenoplosbaarheid van proteïene kan vinnig oor spesies gegenereer word, en met data wat nou beskikbaar is oor 13 spesies wat wissel van mens tot archaea spesies. Dus, ons voorsien dat die TPCA-analise-benadering wyd aangeneem kan word om proteïenkomplekse en proteïeninteraksies oor die boom van die lewe te bestudeer [96,96,98].


Metodes

Biochemiese prosesse (soos proteolise) kan deur gewone differensiaalvergelykings (ODEs) beskryf word. Dit laat toe om 'n proses te simuleer en te ontleed en sodoende gevolgtrekkings te maak oor sy eienskappe, soos bestendige toestande of veranderinge in konsentrasie van sy bestanddele oor tyd. 'n Eenvoudige voorbeeld vir so 'n stelsel is Tyson’ se selsiklusmodel [18]. Om hierdie ODE-stelsels te visualiseer word dikwels grafieke gebruik, waar nodusse die reaktante is en rande tussen hulle die reaksies. Let daarop dat beide voorstellings (ODE en grafiek) ekwivalent is. Vir modellering en visualisering van proteolitiese prosesse Kluge et al. het die bekendgestel splitsingsgrafiek [17] wat hulle gebruik het om eksoproteolitiese splitsingsreaksies te modelleer. In die volgende sal ons hierdie konsep uitbrei om ook endoproteolitiese reaksies in te sluit. Ons noem die resulterende datastruktuur degradasie grafiek aangesien dit gebruik kan word om alle degradasiereaksies van 'n proteolitiese proses te modelleer en ook 'n gerieflike en verstaanbare visualisering moontlik maak.

Degradasie Grafiek

'n Proteolitiese proses waar enkele of veelvuldige peptiede gegenereer word deur peptiede in kleiner fragmente te sny, kan as 'n grafiek gemodelleer word .

Die nodusse V stem ooreen met die afgebreekte en gegenereerde peptiede en die rande E tot die proteolitiese reaksies. Aangesien proteolise 'n onomkeerbare reaksie onder fisiologiese toestande is, is die rande in die grafiek gerig vanaf die afgebreekte na die gegenereerde peptiede.

Soos hierbo genoem, kan 'n mens twee tipes proteolitiese reaksies onderskei, eksoproteolitiese reaksies, waar 'n enkele aminosuur van een van die vrye termini van die peptied verwyder word, en endoproteolitiese reaksies, waar die geteikende peptied op 'n posisie tussen die N- en C-terminus. Vir eksoproteolitiese reaksies verbind ons twee nodusse met 'n gerigte rand vanaf nodus u aan v as ons die aminosuurvolgorde van kan kry v deur 'n enkele aminosuur van die begin of die einde van die aminosuurvolgorde van af te trek u. Vir endoproteolitiese reaksies is dit nie so maklik nie. Aangesien ons drie nodusse moet verbind (die peptied wat geteiken word u en die twee gevolglike fragmente v,w) ons moet die idee breek dat een reaksie gelyk is aan een rand in die grafiek. Om te verseker dat ons steeds die reaksie met enkelrand assosieer, stel ons pseudo-nodes in , wat die endoproteolitiese proses verteenwoordig om die peptied te sny u op 'n spesifieke posisie c. Die pseudo-nodes kan ook gesien word as voorstelling van die endoprotease wat die peptied sny u by posisie c. Ons kan nou verbind u aan en assosieer alle reaksie spesifieke inligting (bv. reaksietempo) met hierdie enkele rand. Ons verbind verder aan v en w met sogenaamde pseudo-rande.

Beide reaksietipes word afsonderlik in Figuur 3 getoon. 'n Voorbeeld met werklike peptiedvolgordes en beide reaksietipes word in Figuur 2 getoon.

(a) Eksoprotease reaksie, (b) Endoprotease reaksie. Sien Figuur 2 vir 'n voorbeeld wat beide reaksietipes bevat.

Konstruksie van die grafiek uit massaspektrometrie data

In die vorige afdeling het ons die degradasiegrafiek en sy verband met proteolitiese prosesse gedefinieer. Nou bied ons 'n benadering aan om hierdie grafiek te konstrueer gebaseer op reekse van N massaspektra wat op verskillende tydpunte versamel is en 'n saadvolgorde S wat ons van hier af ook basispeptied sal noem. Op grond van hierdie insette probeer ons seine in die massaspektra identifiseer, wat fragmente van verteenwoordig S geproduseer deur 'n proteolitiese proses. Die saadvolgorde moet as invoer verskaf word. Dit kan byvoorbeeld die volgorde wees van 'n bekende peptiedprobe wat geïnkubeer is met 'n onbekende mengsel van proteases of 'n volgorde geneem uit MS/MS-identifikasies.

Ons stel kortliks 'n paar notasie bekend wat die begrip van die volgende verduidelikings vergemaklik. Gegee 'n nodus v in die degradasiegrafiek, dui die aminosuurvolgorde van die peptied aan wat met die nodus geassosieer word v. Die lengte van die aminosuurvolgorde word gegee deur . met is die opeenvolging van die aminosuurvolgorde vanaf posisie a te posisioneer b. dui die massa van die peptied aan wat met die nodus geassosieer word v. As ons 'n sein kon identifiseer wat ooreenstem met die peptied wat verband hou met v, sal ons dit’s intensiteit aandui met . Die assosiasie tussen massa en intensiteit neem in ag dat massaspektrometers slegs massa tot lading verhoudings meet en dus nie peptiede met gelyke massa kan onderskei nie. Daarom kan verskillende peptiede met gelyke massa met dieselfde intensiteitswaarde geassosieer word, sonder om die sein twee keer in die latere analise te tel. Die stel van alle peptiedmassas in die grafiek word aangedui deur M. Ons stel verder 'n tou nodusse bekend L, wat leeg is aan die begin van die konstruksie.

Die konstruksie van die grafiek word in twee dele verdeel, verifikasie en uitbreiding, wat op elk van die insetspektra uitgevoer word. Voordat ons hierdie stappe kan uitvoer, moet ons die degradasiegrafiek inisialiseer. Dit word gedoen deur 'n nodus vir die saadvolgorde by die degradasiegrafiek te voeg. Daarna begin ons met die verifikasiestap vir die eerste spektrum wat op tydstip aangeteken is , gevolg deur die uitbreidingstap. Dit word herhaal vir elk van die insetspektra. Die pseudokode vir beide dele word in die ondersteunende inligting (Figuur S1) getoon.

Verifikasie

Die eerste stap is die verifikasie van die degradasiegrafiek op die nuwe spektrum. Ons kyk dus vir elke nodus in die degradasiegrafiek of ons 'n sein kan vind wat ooreenstem met hierdie nodus in die spektrum.Oor die algemeen sal ons seine identifiseer deur peptiedmassa-vingerafdrukke [19]. Ons benadering word beskryf in die Ondersteunende Inligting (Teks S1). Bestaande MS/MS-identifikasies [20] word uitsluitlik vir validering gebruik, aangesien die staatmaak op slegs MS/MS-identifikasies tydens die konstruksiefase van die algoritme 'n vooroordeel in die rigting van die gebruikte verkrygingstrategie sal inbring. Elke nodus v wat in die spektrum geïdentifiseer kan word, word bygevoeg L en geannoteer met die waargenome intensiteit .

Uitbreiding

Die uitbreidingstap word solank op die huidige spektrum uitgevoer L is nie leeg nie. In elke siklus 'n nodus u verwyder word van L en die volgende prosedure word uitgevoer.

Gegewe die nodus u, begin ons deur die N- en C-terminale aminosuur afsonderlik van te verwyder om eksoproteolitiese degradasie te simuleer en na die ooreenstemmende seine te soek. As ons 'n sein kry, voeg ons die ooreenstemmende nodus by v by die grafiek, annoteer dit met die seinintensiteit , stel dit se volgorde in aan óf of , en verbind die nodusse u en v deur 'n rand wat vanaf wys u aan v. Die gegenereerde nodus v is by die lys aangeheg L.

Vervolgens simuleer ons die endoproteolitiese reaksies deur die volgorde te verdeel in twee dele by elke posisie c met . As ons albei fragmente van so 'n verdeling in die massaspektrum kan identifiseer, voeg ons 'n pseudo-node by , geannoteer met die volgorde en die snyposisie c na die grafiek en koppel dit aan die gedegradeerde nodus u. Ons voeg dan nodusse by v en w vir elk van die fragmente op die grafiek, annoteer dit met die ooreenstemmende seinintensiteite (, ), die rye ( en ), en koppel dit aan die pseudo-node . Die gegenereerde nodusse word by die lys aangeheg L.

Beraming van kinetiese parameters

Nadat ons die model gegenereer het wat die proteolitiese proses verteenwoordig, dit wil sê die degradasiegrafiek, is die volgende taak om die kinetiese parameters van die onderliggende proses te skat. Om dit te bereik genereer ons eers 'n stelsel van gewone differensiaalvergelykings (ODE) gebaseer op 'n degradasiegrafiek soos beskryf in die volgende afdeling. Vir hierdie stelsel skat ons die kinetiese parameters gebaseer op die waargenome seinintensiteite.

Genereer 'n ODE-model vir die degradasiegrafiek

Na aanleiding van die idees wat deur Yi et al. [16] die wiskundige model word afgelei deur die wet van massa-aksie en elke proteolitiese reaksie word gemodelleer as 'n eerste-orde reaksie, dit wil sê die tempo van die reaksie hang af van die konsentrasie van slegs een reaktant. In die geval van proteolitiese reaksies is hierdie reaktant die proteïen of peptied wat afgebreek word. Ons verwaarloos newe-effekte soos versadiging van die afbraakprodukte, maar om dit in te sluit sal moontlik wees deur 'n uitbreiding van die ODE-stelsel. Ons skryf die tempovergelykings vir 'n eksoprotease reaksie, waar u word gedegradeer tot v soos volg

waar en dui die konsentrasie van peptied aan u en v op tyd t. is die kinetiese tempo konstante vir die reaksie. Endoprotease-reaksies word op dieselfde manier voorgestel met die geringe verskil wat ons nodig het om beide afgebreekte produkte te modelleer.

Hierdie transformasie kan vir elke reaksie en elke reaktant in die degradasiegrafiek gedoen word. As 'n voorbeeld het ons die degradasiegrafiek getoon in Figuur 2 in die volgende stelsel van differensiaalvergelykings omskep.

Sedert die degradasie proses sowel as die massaspektrometrie metings gebeur eks-vivo, die basis peptied ( in die voorbeeld hierbo) het 'n vaste beginkonsentrasie en daar sal geen verdere produksie van die basispeptied wees nie. In instellings waar dit nie geld nie, sal 'n mens die generering van die basispeptied eksplisiet in die vergelykings moet modelleer (bv. deur 'n konstante generasietempo).

Transformasie van peptiedkonsentrasies na seinintensiteite

Die voorgestelde ODE-model is gebaseer op konsentrasies van peptiede, maar met 'n massaspektrometer kan ons slegs intensiteite wat met 'n spesifieke massa geassosieer word, waarneem. Die ooglopende vraag is watter soort verwantskap bestaan ​​vir 'n enkele peptied tussen sy konsentrasie en die intensiteit wat met die massaspektrometer waargeneem word. Boonop kan 'n mens nie waarborg dat twee peptiede met gelyke konsentrasie dieselfde intensiteit in die massaspektrometer sal hê nie.

Verskillende studies [21], [22] het getoon dat vir 'n enkele peptied 'n lineêre verband tussen intensiteit en konsentrasie 'n redelike aanname is. Op grond hiervan het ons 'n lineêre transformasie van die modelkonsentrasies na die voorspelde seinintensiteite ingestel.

waar is die intensiteit wat met die massa geassosieer word m op tydstip t, m is die massa van die peptied , is 'n peptied spesifieke faktor, en die konsentrasie, bereken deur die model, vir peptied op tydstip . Yi et al. [16] het reeds 'n soortgelyke transformasie suksesvol in hul studie gebruik. Hierdie transformasie los implisiet ook die tweede probleem van vergelykbaarheid tussen twee waargenome intensiteite op. Aangesien elke waargenome intensiteit individueel in die gemeenskaplike konsentrasiedomein getransformeer sal word, kan die gevolglike konsentrasies daarna vergelyk word. Hierdie transformasie kan ook gebruik word om te kompenseer vir sistematiese effekte wat in elke meting voorkom, bv. kwantifiseringsfoute of onvolledige ionisasie.

Nog 'n probleem is dat dit kan gebeur dat twee of meer verskillende peptiede dieselfde of 'n byna identiese massa het. Hierdie isobariese peptiede kan nie in 'n massaspektrum onderskei word nie. Ons transformeer hulle dus in 'n enkele intensiteitswaarde. Vir elke waargenome massa , bereken ons 'n lineêre kombinasie van alle peptiedkonsentrasies, van peptiede met 'n massa gelyk aan (of amper gelyk aan) .

waar is die stel van alle peptiede wat 'n massa het van .

Skat reaksietempo's

Om kinetiese parameters te skat, het ons eers 'n ODE-model gegenereer gebaseer op 'n degradasiegrafiek soos hierbo beskryf. Ons moet nou die optimale stel modelparameters () sowel as transformasie parameters (), sodat die verskil tussen die berekende model intensiteite en die waargenome intensiteite is minimaal. Na aanleiding van standaard praktyk gebruik ons ​​'n geweegde som van kleinste kwadrate verskille tussen waargenome en model intensiteite as 'n fout maatstaf.

waar is die stel van alle waargenome massas, is die intensiteit waargeneem vir massa op tydstip , is intensiteit voorspel deur ODE-stelsel vir die massa op tydstip , en is 'n gewigsfunksie. Die gewigsfunksie kan byvoorbeeld gebruik word om relatiewe in plaas van absolute afwykings te gebruik, d.w.s.

Dit word gebruik om die effek van verskillende intensiteite wat op verskillende grootteordes is, te verminder. Hierdie minimaliseringsprobleem kan teoreties opgelos word deur enige beskikbare optimeringstegniek. Nadat ons verskillende beskikbare tegnieke getoets het, het ons besluit om POEM, 'n Matlab-gebaseerde weergawe van BioPARKIN [23], [24], te gebruik om die modelparameters sowel as die transformasieparameters te skat. Ons gebruik verder POEM om die aanvanklike konsentrasie van die basispeptied te skat. GEDIG is gebaseer op gedempte Gauss-Newton tegnieke vir die oplossing van bogenoemde optimeringsprobleem. Gebrek aan robuustheid van gedempte Gauss-Newton tegnieke soos dikwels waargeneem in model diskriminasie kontekste, sien [25], kan oorkom word deur die gebruik van dimensie vermindering in parameter ruimte [26].

Hoe om beginwaardes te kies

Aangesien die voorkennis oor die gemodelleerde stelsel baie beperk is, is goeie aanvanklike waardes vir die skatting van die modelparameters moeilik om te vind. Ons het dus die beginwaardes gekies op grond van die volgende skema: Vir elke knoop word die rand (d.i. proteolitiese reaksie) gekies, wat op die kortste pad na die wortelknoop lei. Vir die ooreenstemmende reaksietempo () ken ons 'n beginwaarde toe van . Vir alle ander inkomende reaksies word die aanvanklike waarde op 'n waarde van gestel . Alle transformasie parameters () is ingestel op .

Evaluering en Optimalisering van die Degradasiegrafiekstruktuur

Die bogenoemde benadering om die degradasiegrafiek te konstrueer is gulsig, dit wil sê, dit aanvaar dat elke sein in 'n spektrum wat kan ooreenstem met 'n subsekwensie van die basispeptied deel is van die proteolitiese proses en dat elke moontlike reaksie plaasgevind het. Hierdie aanname is nie altyd waar nie. Die seine kan ook afkomstig wees van peptiede met gelyke of ten minste soortgelyke massas soos ons reeds in die vorige afdeling gesien het. Maar hierdie peptiede neem nie noodwendig deel aan die proteolitiese reaksies wat ons wil modelleer nie. Ons sal sulke peptiede noem lokmiddel peptiede. Alternatiewelik kan ons veelvuldige reaksies hê om die vorming van 'n peptied te verduidelik waar slegs een waar is. Gevolglik kan die degradasiegrafiek peptiede of reaksies bevat wat nie in die werklike onderliggende proteolitiese proses plaasgevind het nie. Om hiervoor rekening te hou, bied ons 'n metode aan om verskillende subgrafieke van 'n aanvanklike degradasiegrafiek te rangskik met betrekking tot hul vermoë om waargenome data te verduidelik. Gevolg deur 'n heuristiese benadering om 'n reeks kleiner modelle van die aanvanklik gegenereerde degradasiegrafiek te konstrueer sonder dat dit nodig is om elke moontlike subgrafiek te bereken.

Evaluering van verskillende modelle

Om die degradasiegrafiek te vind wat die waargenome data optimaal verduidelik, is dit nodig om die verskillende grafieke te rangskik. Hier beskryf ons 'n punteskema wat gebruik kan word om die gegenereerde modelle te rangskik.

Om die volgende verduidelikings te vergemaklik, sal ons 'n paar verdere notasie bekendstel. Gegee 'n degradasiegrafiek , 'n subgrafiek word gedefinieer as , waar en . Ons vereis dit ook is verbind, dit wil sê vir alle pare nodusse bestaan ​​'n pad van lengte in wat verbind en . Die subgrafiek definieer ook as die subset van alle massas en hul gepaardgaande intensiteite wat deur die subgrafiek verduidelik word .

Die voorgestelde telling bestaan ​​uit twee komponente. Die eerste telling komponent is die gemiddelde Pearson-korrelasie van die intensiteite voorspel deur die model (met beraamde reaksieparameters) en die werklike waargenome data. Hierdie komponent moet die goeie passing tussen die gemete intensiteite en die berekende modelintensiteite weerspieël. Ons bereken vir elke verduidelikde massa die Pearson-korrelasie tussen die waargenome intensiteitswaardes en die voorspelde waardes van die model.

Ons gebruik dan die gemiddelde van alle Pearson-korrelasiewaardes as maatstaf vir die goedheid van passing.

Die tweede komponent van die telling is die deel van die standaardafwyking van die oorspronklike degradasiegrafiek, wat deur die spesifieke subgrafiek bewaar word.

waar is die standaardafwyking van die sein wat ooreenstem met die massa . weerspieël die vermoë van die subgrafiek om die belangrike dele van die oorspronklik versamelde seine te verduidelik.

Om 'n enkele telling te bereken uit hierdie twee komponente bou ons die geweegde som van beide tellings.

Om goeie gewigte te bepaal en ons het verskeie eksperimente op gesimuleerde data uitgevoer. 'n Gewig van vir die korrelasietelling en vir die veranderlikheidtelling die beste skeiding van die korrek en verkeerd geïdentifiseerde modelle getoon. Vir datastelle met lae gehalte (bv. as gevolg van hoë hoeveelhede geraas of te min steekproefpunte) gewigte van en goeie vertoning getoon het. Vir sulke datastelle verwag ons 'n minder betroubare passing vir die tydreeks en het dus die gewigsfaktor vir die kwaliteit van die passing verlaag.

Heuristiese soektog vir die optimale grafiek

Om alle moontlike subgrafieke te konstrueer, die geassosieerde ODE-stelsel te genereer en die ooreenstemmende reaksie- en transformasieparameters te skat is moontlik vir klein grafieke. Met toenemende grootte in terme van aantal nodusse en reaksies, word die skatting van die reaksie- en transformasieparameters vir alle subgrafieke meer berekeningsintensief. As ons elke moontlike kombinasie van reaksies wil genereer, sal ons kry moontlike subgrafieke. Selfs as ons sommige van die subgrafieke uitfiltreer (bv. diegene wat nie die wortelnodus bevat nie of nie verbind is nie), sal ons steeds eksponensieel baie subgrafieke moet oorweeg. Vir elk van hierdie subgrafieke sal ons dan die geassosieerde ODE-stelsel moet aflei en die reaksie- en oorgangsparameters skat.

Om hierdie prosedure te bespoedig, bied ons 'n heuristiese benadering aan. Voorlopige toetse het getoon dat die voorgestelde grafiektelling verbeter as die struktuur van die degradasiegrafiek nader aan die oorspronklike een kom. Dit kan verduidelik word op grond van die samestelling van die partituur. Die eerste komponent weerspieël die goeie passing tussen model en waargenome data. Dit behoort te verbeter as ons peptiede en reaksies verwyder wat nie aan die onderliggende proses behoort nie. Die tweede komponent weerspieël die veranderlikheid van die seine. As ons slegs nodusse verwyder wat nie aan die reaksie deelneem nie, dit wil sê wie se variasie laag is in vergelyking met die seine van peptiede wat afgebreek en geproduseer word, behoort hierdie tellingkomponent steeds naby die optimale waarde te wees.

Gebaseer op die konstruksie-algoritme weet ons dat die geïdentifiseerde degradasiegrafiek maksimaal is in die sin dat dit alle seine bevat wat deur die veronderstelde proses geproduseer is en moontlik ook dele wat nie tot die proses behoort nie. Om die optimale subgrafiek te vind, begin ons deur alle terminale reaksies van die grafiek (d.i. reaksies wat ten minste een blaar produseer) afsonderlik te verwyder. Vir elk van hierdie subgrafieke skat ons die kinetiese parameters soos vroeër beskryf. Vervolgens beoordeel ons alle subgrafieke volgens die kriteria wat hierbo aangebied word. Dan vat ons die beste modelle en verwyder weer alle blare afsonderlik. Ons gaan voort met hierdie prosedure solank ons ​​ten minste een grafiek kan vind waarvan die telling onder die bokant is van alle tot dusver berekende subgrafieke en wat nie in 'n vorige iterasie afgesny is nie.

Met hierdie benadering kan ons die hoeveelheid parameteroptimalisasies wat uitgevoer moet word drasties verminder deur steeds die oorspronklik ingebedde grafiek te vind.

Voorlopige toetse het daardie instelling getoon tot óf 2 óf 3 is voldoende om die aantal onnodige model-evaluasies effektief te bind terwyl die oorspronklike degradasiegrafiek steeds geïdentifiseer word.

Looptyd-oorwegings

Die bogenoemde kombinasie van degradasiegrafiekkonstruksie, parameterberaming en struktuuroptimalisering verg 'n aansienlike hoeveelheid tyd, indien die aanvanklike degradasiegrafiek groot is. Daarom beskryf ons nou 'n benadering van die looptyd in die ergste geval. Die looptyd van die aanvanklike degradasiegrafiekkonstruksie word bepaal deur die aantal verifikasies wat nodig is. Onder die aanname dat ons die volledige degradasiegrafiek sou konstrueer, dit wil sê, alle peptiede word op elke moontlike manier afgebreek, sal 'n mens 'n degradasiegrafiek skep, wat alle moontlike substringe van die aanvanklike peptiedvolgorde bevat. Aangesien ons elkeen van hierdie substringe een keer sal moet verifieer, word die looptyd in die ergste geval begrens deur die maksimum aantal moontlike substringe van die aanvanklike peptiedvolgorde. Gegee 'n saadvolgorde van lengte ons kan hoogstens bou moontlike fragmente, wat in die spektrum nagegaan kan word. As ons nou ontleed spektra wat ons hoogstens sal hê verifikasies.

Die kompleksiteit van die parameterberamingsprosedure kan benader word deur , waar is die aantal tydpunte, dit wil sê die aantal geëvalueerde massaspektra, en is die aantal onbekende parameters, dit wil sê die aantal rande in die grafiek minus die aantal rande wat pseudo- en werklike nodusse verbind. Gegewe dit, sal die tyd wat benodig word vir die parameterskatting afneem met die subgrafieke wat kleiner word. Onder die aanname dat selfs die voorgestelde heuristiek die berekening van elke subgrafiek kan vereis, sal ons moet aktiveer optimalisering in die ergste geval.


FAK-fosforileringsplekke gekarteer deur massaspektrometrie

Pablo R. Grigera, Erin D. Jeffery, Karen H. Martin, Jeffrey Shabanowitz, Donald F. Hunt, J. Thomas Parsons FAK-fosforileringsterreine gekarteer deur massaspektrometrie. J Sel Sci 1 November 2005 118 (21): 4931–4935. doi: https://doi.org/10.1242/jcs.02696

Die proteïen-tyrosienkinase, fokale adhesiekinase (FAK), is 'n sentrale reguleerder van integrien-gemedieerde sein (Mitra et al., 2005 Parsons, 2003 Schlaepfer en Mitra, 2004). FAK is teenwoordig in fokale adhesies, kleefstrukture wat aanhegting van selle aan die ekstrasellulêre matriks (ECM) bemiddel (Hynes, 1992 Lauffenburger en Horwitz, 1996). Daarbenewens is FAK teenwoordig in ander adhesiestrukture binne die sel, veral die dinamiese adhesiekomplekse wat aan die periferie van lamellipodia van migrerende selle gevind word (Webb et al., 2004). FAK is noodsaaklik vir die omset (bv. afbreek) van hierdie laasgenoemde klas seladhesies en is ook geïmpliseer in die vrystelling van adhesie aan die agterkant van die sel (Carragher et al., 2001 Webb et al., 2004). Inhibisie van FAK-aktiwiteit of geteikende uitwissing van FAK-uitdrukking lei tot selmigrasie-defekte (Ilic et al., 1995 Richardson et al., 1997a Schlaepfer en Mitra, 2004). Verhoogde FAK-uitdrukking is 'n kenmerk van baie kankers en kan bydra tot die metastatiese fenotipe van hoogs kwaadaardige selle (Gabarra-Niecko et al., 2003).

Groepering van seloppervlakintegriene, as gevolg van selaanhegting aan ECM-proteïene of behandeling met sekere integrienspesifieke teenliggaampies, lei tot die aktivering van FAK-katalitiese aktiwiteit en 'n toename in FAK-tirosienfosforilering (Mitra et al., 2005 Parsons, 2003) . Aktivering van FAK lei tot outofosforilering van Y397, die werwing van Src- en Src-familiekinases, en die verhoogde fosforilering van ander proteïene teenwoordig in die adhesiekomplekse, veral paxillin en p130Cas (Mitra et al., 2005). Die huidige bewyse dui daarop dat die aanvang van hierdie tirosienfosforileringskaskade noodsaaklik is vir die stroomaf-sein wat deur sellulêre adhesiekomplekse bemiddel word. Benewens die feit dat dit 'n proteïen-tirosienkinase is, blyk dit dat FAK 'n steierfunksie verrig, wat aan 'n verskeidenheid membraan-geassosieerde proteïene bind, insluitend groeifaktorreseptore en ERM-proteïene. In adhesies kolokaliseer FAK met en bind aan die fokale adhesieproteïene paxillin, p130Cas en talin, sowel as SH3-domein-bevattende GTPase-aktiverende proteïene vir die Rho en Arf familie van klein GTPases. Daarbenewens blyk die fosforilering van spesifieke tirosienreste belangrik te wees vir die werwing van SH2-domein-bevattende seinproteïene, insluitend Src- en Src-familiekinases, PI 3-kinase en Grb2 (Mitra et al., 2005 Parsons, 2003 Parsons et al. al., 2000).

Min is bekend oor die ruimtelike en tydelike organisasie van FAK in nuutgevormde of meer stabiele sellulêre adhesies.Verder is min inligting beskikbaar oor die faktore wat die ensiematiese aktivering van FAK of die interaksie van FAK met sy bindende proteïene reguleer. Om die moontlike rol van post-translasionele modifikasies op die regulering van FAK-funksie te verstaan, het ons die fosforileringsplekke binne FAK gekarteer deur immunoaffiniteitsuiwering van FAK en massaspektrometrie (MS) te gebruik. In hierdie verslag identifiseer ons 25 plekke van fosforilering (15 serien-, 5 treonien- en 5 tirosienreste), insluitend 'n aantal van die serien- en tirosienfosforileringsplekke wat voorheen gerapporteer is. Daarbenewens let ons op die jukstaposisie van fosfoserien-, fosfotreonien- en fosfotirosien-bevattende residue, wat daarop dui dat gekoördineerde fosforilering van FAK deur serien/treonien en tirosien-spesifieke kinases 'n belangrike aspek van regulering van FAK-funksie kan wees.

Om die plekke van fosforilering in FAK te identifiseer, is MS-analise uitgevoer op FAK-immuunkomplekse wat voorberei is vanaf HEK293-selle wat hoender-FAK uitdruk. In sommige gevalle is die selle voorbehandel met fosfatase-inhibeerders om die herstel van gefosforileerde residue te verbeter. Deur hierdie analise is peptiede wat 90% van die FAK-proteïen verteenwoordig, geïdentifiseer. Fig. 1 toon die volgorde van FAK met al die waargenome fosforileringsplekke in rooi gemerk. Die aminosuurnommering in hierdie verslag is gebaseer op die hoendervolgorde, wat effens verskil van die nommering vir menslike of muis-FAK. Die streke van die proteïen wat nie deur hierdie MS-analise geïdentifiseer is nie, word in kleinletters getoon. Die fosforilering van residue binne hierdie streke is dus onbekend. Daarbenewens was daar twee gevalle waarin die spesifieke gefosforileerde aminosure binne 'n peptied nie deur die MS/MS-spektra (getoon tussen hakies) toegeken kon word nie. 'n Totaal van 38 fosfopeptiede is geïdentifiseer, en hul volgordes is bevestig deur handmatige inspeksie van die spektra (Tabel 1). Uit hierdie peptiede het ons die fosforilering van 15 serien-, 5 treonien- en 5 tirosienresidu geïdentifiseer.

Relatiewe oorvloed van fosfopeptiede geïdentifiseer deur massaspektrometrie

. . Relatiewe oorvloed. .
Residu . FAK-peptiedvolgorde (hoender) . (+) Inhibeerders . (–) Inhibeerders .
T13 DPNLNHTPSSSAK ++
S29 THLGTGMERSPGAMERVLK +++ ++++
Y155 NDYMLEIADQVDQEIALK ++++
S386/T388 QGVRSHTVSVSETDDYAEIIDEE IMAC
S386/T388 GVRSHTVSVSETDDYAEIIDEE IMAC
S386/S390 KQGVRSHTVSVSE IMAC
T388/S390 KQGVRSHTVSVSE IMAC
T388/S392 QGVRSHTVSVSETDDYAEIIDEE IMAC
T388/Y397 QGVRSHTVSVSETDDYAEIIDEE IMAC
S390 QGVRSHTVSVSETD IMAC
S390 QGVRSHTVSVSETDDYAEIIDEE ++ IMAC
S390 GVRSHTVSVSET IMAC
S390/[T394-Y397] QGVRSHTVSVSE [TDDY] AEIIDEE IMAC
[T394-Y397] QGVRSHTVSVSE [TDDY] AEIIDEE IMAC
Y397 QGVRSHTVSVSETDDYAEIIDEE ++
T406/Y407 DTYTMPSTRDYE IMAC
Y570 DFGLSRYME IMAC +
T700/S708 RMRMESRRQVTVSWDSGGSD ++++
S722/[S725-S726] DEAPPKPSRPGYPSPR [SS] EGF IMAC
S732 GFYPSPQHMVQPNHYQVSGYSGSHGIPAMAGSIYPGQASLLDQTDSWNHRPQE IMAC
S766 SHGIPAMAGSIYPGQASLL IMAC
T793 DSGTLDVRGMGQVLPTHLM IMAC
S845 RFLVMKPDVRLSRGSIE IMAC
S888 KPPRPGAPHLGSLASLNSPV ++++
S888 KPPRPGAPHLGSLASLNSPVDSYNEGVK +++
S888/S891 KPPRPGAPHLGSLASLN IMAC
S888/S891 KPPRPGAPHLGSLASLNSPV IMAC
S888/S891/S894 KPPRPGAPHLGSLASLNSPV IMAC
S888/S894 KPPRPGAPHLGSLASLNSPV +++
S888/S894 KPPRPGAPHLGSLASLNSPVDSYNEGVK +++
S894 KPPRPGAPHLGSLASLNSPV ++++
S894 KPPRPGAPHLGSLASLNSPVDSYNE IMAC
S894 KPPRPGAPHLGSLASLNSPVDSYNEGVK ++++
S894/S898 KPPRPGAPHLGSLASLNSPVDSYNEGVK ++
S894/S898/Y899 KPPRPGAPHLGSLASLNSPVDSYNEGVK IMAC
S894/Y899 SLNSPVDSYNEGVK IMAC
S911 IKPQEISPPPTANL ++++ ++++
S911 IKPQEISPPPTANLDRSNDK ++++
. . Relatiewe oorvloed. .
Residu . FAK-peptiedvolgorde (hoender) . (+) Inhibeerders . (–) Inhibeerders .
T13 DPNLNHTPSSSAK ++
S29 THLGTGMERSPGAMERVLK +++ ++++
Y155 NDYMLEIADQVDQEIALK ++++
S386/T388 QGVRSHTVSVSETDDYAEIIDEE IMAC
S386/T388 GVRSHTVSVSETDDYAEIIDEE IMAC
S386/S390 KQGVRSHTVSVSE IMAC
T388/S390 KQGVRSHTVSVSE IMAC
T388/S392 QGVRSHTVSVSETDDYAEIIDEE IMAC
T388/Y397 QGVRSHTVSVSETDDYAEIIDEE IMAC
S390 QGVRSHTVSVSETD IMAC
S390 QGVRSHTVSVSETDDYAEIIDEE ++ IMAC
S390 GVRSHTVSVSET IMAC
S390/[T394-Y397] QGVRSHTVSVSE [TDDY] AEIIDEE IMAC
[T394-Y397] QGVRSHTVSVSE [TDDY] AEIIDEE IMAC
Y397 QGVRSHTVSVSETDDYAEIIDEE ++
T406/Y407 DTYTMPSTRDYE IMAC
Y570 DFGLSRYME IMAC +
T700/S708 RMRMESRRQVTVSWDSGGSD ++++
S722/[S725-S726] DEAPPKPSRPGYPSPR [SS] EGF IMAC
S732 GFYPSPQHMVQPNHYQVSGYSGSHGIPAMAGSIYPGQASLLDQTDSWNHRPQE IMAC
S766 SHGIPAMAGSIYPGQASLL IMAC
T793 DSGTLDVRGMGQVLPTHLM IMAC
S845 RFLVMKPDVRLSRGSIE IMAC
S888 KPPRPGAPHLGSLASLNSPV ++++
S888 KPPRPGAPHLGSLASLNSPVDSYNEGVK +++
S888/S891 KPPRPGAPHLGSLASLN IMAC
S888/S891 KPPRPGAPHLGSLASLNSPV IMAC
S888/S891/S894 KPPRPGAPHLGSLASLNSPV IMAC
S888/S894 KPPRPGAPHLGSLASLNSPV +++
S888/S894 KPPRPGAPHLGSLASLNSPVDSYNEGVK +++
S894 KPPRPGAPHLGSLASLNSPV ++++
S894 KPPRPGAPHLGSLASLNSPVDSYNE IMAC
S894 KPPRPGAPHLGSLASLNSPVDSYNEGVK ++++
S894/S898 KPPRPGAPHLGSLASLNSPVDSYNEGVK ++
S894/S898/Y899 KPPRPGAPHLGSLASLNSPVDSYNEGVK IMAC
S894/Y899 SLNSPVDSYNEGVK IMAC
S911 IKPQEISPPPTANL ++++ ++++
S911 IKPQEISPPPTANLDRSNDK ++++

Elkeen van die fosfopeptiede wat vanaf FAK geïdentifiseer is, word gelys, met die gefosforileerde residu(e) in rooi getoon. Die gefosforileerde aminosure tussen hakies kon nie onderskei word nie. In sommige eksperimente is die selle voor lisis met fosfatase-inhibeerders behandel. Al die selle is gelys in die teenwoordigheid van inhibeerders. Relatiewe fosfopeptied oorvloed word uitgedruk in terme van ioontellings (piekhoogtes) waargeneem vir die volopste ladingtoestand. Ioontellings vir die mees volopste fosfopeptiede word vertoon as ++++ dié wat ioonstrome vertoon wat met 'n faktor van 10, 100 en 1000 verminder is, word onderskeidelik as +++, ++ en + getoon. Die relatiewe oorvloed van peptiede kan slegs binne 'n individuele eksperiment vergelyk word en dus kan peptiede wat onder verskillende toestande geïdentifiseer is op verskillende vlakke in verskillende eksperimente teenwoordig gewees het. Ons het die hoogste relatiewe hoeveelheid wat waargeneem is, aangedui. Peptied oorvloed met `+' inhibeerders kan nie vergelyk word met oorvloed sonder `–' inhibeerders. In sommige gevalle is peptiede slegs waargeneem na verryking met geïmmobiliseerde metaalaffiniteitschromatografie (IMAC), wat aandui dat hierdie peptiede in beperkte hoeveelhede teenwoordig was.

Fig. 2 toon die superposisie van die bespeurde fosforileringsplekke op die domeinstruktuur van FAK. 'n Aantal kenmerke van die fosfo-landskap is opvallend. Die N-terminale FERM-domein dien 'n outo-inhiberende funksie (Cooper et al., 2003 Dunty et al., 2004) en as 'n brug na groeifaktorreseptore en membraanadapterproteïene soos ezrin (Poullet et al., 2001 Sieg et al. , 2000). Twee plekke van fosforilering, T13 en S29, is waargeneem N-terminaal aan die begin van die FERM-domein. Beide residue word in FAK van mens, muis en padda bewaar, wat bewaring van funksie in hierdie streek aandui (Tabel 2). Hierdie streek is uniek aan FAK en deel nie volgorde-ooreenkoms met die verwante FAK-kinase, PYK2/CAKβ nie. In die middel van die FERM-domein is Y155 'n plek van fosforilering. Y155, wat in FAK van die mens, muis en padda bewaar word, sowel as in PYK2, is proksimaal aan die voorheen geïdentifiseerde plek van FAK-sumoylering, en fosforilering van hierdie residu kan 'n rol speel in die regulering van kernhandel van FAK (Kadare et al. ., 2003).

Bewaring van fosforileringsterreine tussen spesies

. Spesiebewaring. . .
Residu . Mens . Muis . Xenopus .
T13 + + -
S29 + + +
Y155 + + +
S386 - - -
T388 - - -
S390 + + +
S392 + + +
[T394] + + +
Y397 + + +
T406 + + +
Y407 + + +
Y570 + + +
T700 + + +
S708 + + +
S722 + + +
[S725] + + +
[S726] + + +
S732 + + +
S766 + + +
T793 - - -
S845 + + +
S888 + - -
S891 + + -
S894 + + +
S898 + + -
Y899 + + +
S911 + + +
. Spesiebewaring. . .
Residu . Mens . Muis . Xenopus .
T13 + + -
S29 + + +
Y155 + + +
S386 - - -
T388 - - -
S390 + + +
S392 + + +
[T394] + + +
Y397 + + +
T406 + + +
Y407 + + +
Y570 + + +
T700 + + +
S708 + + +
S722 + + +
[S725] + + +
[S726] + + +
S732 + + +
S766 + + +
T793 - - -
S845 + + +
S888 + - -
S891 + + -
S894 + + +
S898 + + -
Y899 + + +
S911 + + +

Die volgorde van hoender-FAK is in lyn gebring met die volgordes van mens (GenBank-toetredingsnr. L13616), muis (GenBank-toetredingsnr. M95408) en die padda, Xenopus laevis (GenBank-toetredingsnr. L33920) deur die Clustal-metode deur die DNAstar MegAlign-program te gebruik. Die gefosforileerde aminosure wat identies is, word as `+' getoon. Die nommering van residue was gebaseer op die volgorde van hoender FAK en kan effens verskil vir ander spesies.

Gegroepeerde plekke van fosforilering is waargeneem proksimaal tot die hoofplek van outofosforilering, Y397 (Schaller et al., 1994), en het vyf nuut geïdentifiseerde plekke van fosforilering ingesluit (S386, T388, S390, S392 en T406), wat sowel as Y407, is voorheen geïdentifiseer as 'n plek van Src-fosforilering (Calalb et al., 1995). S390, S392 en T406 word bewaar onder FAK-proteïene van muis, mens en padda, terwyl S386 en T388 hoenderspesifiek is. Die nabyheid van hierdie groep fosforileringsplekke aan Y397 dui daarop dat fosforilering van hierdie residue 'n rol speel in die regulering van FAK ensiematiese aktiwiteit. Huidige bewyse dui aan dat FAK-outofosforilering plaasvind deur die dimerisasie van twee FAK-molekules (Toutant et al., 2002). Die doeltreffendheid van dimerisasie en/of Y397-fosforilering kan beïnvloed word deur die proksimale serien/treonien-fosforilerings. Daarbenewens vorm fosfo-Y397 'n dokplek vir die SH2-domein van Src- en Src-familiekinases (Schaller et al., 1994). Dit is moontlik dat fosforilering die assosiasie van FAK met Src of ander bindingsvennote wat phospho-Y397 as 'n dokplek gebruik, beïnvloed.

Geïdentifiseerde plekke van serien-, treonien- en tirosienfosforilering in FAK. Die volgorde van hoender-FAK (GenBank-toegangsnr. M86656) word met die aminosure wat deur massaspektrometrie (MS) geïdentifiseer is, in hoofletters getoon. Die gefosforileerde residue wat deur die MS-analise geïdentifiseer is, word in rooi getoon. Daar was twee peptiede waarin die gefosforileerde oorskot nie onderskei kon word nie (met hakies aangedui). Omdat T394 slegs waargeneem is binne 'n peptied wat Y397 bevat, 'n bekende plek van fosforilering, is die fosforileringstatus van T394 twyfelagtig.

Geïdentifiseerde plekke van serien-, treonien- en tirosienfosforilering in FAK. Die volgorde van hoender-FAK (GenBank-toegangsnr. M86656) word met die aminosure wat deur massaspektrometrie (MS) geïdentifiseer is, in hoofletters getoon. Die gefosforileerde residue wat deur die MS-analise geïdentifiseer is, word in rooi getoon. Daar was twee peptiede waarin die gefosforileerde oorskot nie onderskei kon word nie (met hakies aangedui). Omdat T394 slegs waargeneem is binne 'n peptied wat Y397 bevat, 'n bekende plek van fosforilering, is die fosforileringstatus van T394 twyfelagtig.


Kyk die video: Multitasken. Het beste brein van Nederland (September 2022).


Kommentaar:

  1. Bayhard

    And how in such a case to enter?

  2. Dairn

    Jy is verkeerd. Kom ons bespreek. E -pos my by PM, ons sal praat.

  3. Carlisle

    Excuse, I have removed this phrase

  4. Woodward

    Beminlik

  5. Mash'al

    U begaan 'n fout. Kom ons bespreek dit. Skryf aan my in PM, ons sal kommunikeer.

  6. Tazilkree

    Gebeur ... sulke toevallige toeval



Skryf 'n boodskap